Name : Recombinant Human Sulfotransferase 1B1, SULT1B1 (N-6His)
Supplier : NOVO
Price :1755
SKU : GEN6273544692
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Sulfotransferase 1B1 is produced by our E, coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 3 kD, 36 |
| UniProt number | O43704 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 0, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | SULT1B1 (N-6His), Sulfotransferase 1B1 |
| Short name | SULT1B1 (N-6His), Recombinant Sulfotransferase 1B1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | SULT1B1 (N-6His), sapiens Sulfotransferase 1B1, recombinant H |
| Alternative technique | rec |
| Identity | 17845 |
| Gene | SULT1B1 |
| Long gene name | sulfotransferase family 1B member 1 |
| Synonyms gene name | 1B, cytosolic, member 1 , sulfotransferase family |
| Synonyms | ST1B2 |
| Locus | 4q13, 3 |
| Discovery year | 2002-01-10 |
| GenBank acession | D89479 |
| Entrez gene record | 27284 |
| Pubmed identfication | 11688987 9443824 |
| RefSeq identity | NM_014465 |
| Classification | Sulfotransferases, cytosolic |
| Havana BLAST/BLAT | OTTHUMG00000129407 |