Name : Recombinant Human Superoxide Dismutase [Cu-Zn], SOD1, Cu-Zn SOD (N-6His)
Supplier : NOVO
Price :2283
SKU : GEN3977722523
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human SOD1 is produced by our E, coli expression system and the target gene encoding Met1-Gln154 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 1 kD, 18 |
| UniProt number | P00441 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | Cu-Zn SOD (N-6His), Superoxide Dismutase [Cu-Zn] SOD1 |
| Short name | Cu-Zn SOD (N-6His), Recombinant Superoxide Dismutase [Cu-Zn] SOD1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | Cu-Zn antioxidant enzyme (N-6His), sapiens Superoxide Dismutase [Cu-Zn], soluble, superoxide dismutase 1, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | ALS and ALS1 and HEL-S-44 and homodimer and hSod1 and IPOA and SOD, SOD1 and IDBG-1609 and ENSG00000142168 and 6647, Sod1 and IDBG-174662 and ENSMUSG00000022982 and 20655, chaperone binding, nuclei, soluble, this GO :0000187 and activation of MAPK activity and biological process this GO :0000302 and response to reactive oxygen species and biological process this GO :0000303 and response to superoxide and biological process this GO :0001541 and ovarian follicle development and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001890 and placenta development and biological process this GO :0001895 and retina homeostasis and biological process this GO :0001975 and response to amphetamine and biological process this GO :0002262 and myeloid cell homeostasis and biological process this GO :0002576 and platelet degranulation and biological process this GO :0004784 and superoxide dismutase activity and molecular function this GO :0005507 and copper ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006749 and glutathione metabolic process and biological process this GO :0006801 and superoxide metabolic process and biological process this GO :0006879 and cellular iron ion homeostasis and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007569 and cell aging and biological process this GO :0007596 and blood coagulation and biological process this GO :0007605 and sensory perception of sound and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008089 and anterograde axon car this GO transport and biological process this GO :0008090 and retrograde axon car this GO transport and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008219 and cell death and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0009408 and response to heat and biological process this GO :0010033 and response to organic substance and biological process this GO :0019226 and transmission of nerve impulse and biological process this GO :0019430 and removal of superoxide radicals and biological process this GO :0019899 and enzyme binding and molecular function this GO :0030141 and secretory granule and cellular component this GO :0030168 and platelet activation and biological process this GO :0030346 and protein phosphatase 2B binding and molecular function this GO :0031012 and extracellular matrix and cellular component this GO :0031045 and dense core granule and cellular component this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0031667 and response to nutrient levels and biological process this GO :0032287 and peripheral nervous system myelin maintenance and biological process this GO :0032314 and regulation of Rac GTPase activity and biological process this GO :0032839 and dendrite cytoplasm and cellular component this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0033081 and regulation of T cell differentiation in thymus and biological process this GO :0034465 and response to carbon monoxide and biological process this GO :0034599 and cellular response to oxidative stress and biological process this GO :0035865 and cellular response to potassium ion and biological process this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0042493 and response to drug and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0042554 and superoxide anion generation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043234 and protein complex and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045541 and negative regulation of cholesterol biosynthetic process and biological process this GO :0045859 and regulation of protein kinase activity and biological process this GO :0046620 and regulation of organ growth and biological process this GO :0046677 and response to antibiotic and biological process this GO :0046688 and response to copper ion and biological process this GO :0046716 and muscle cell cellular homeostasis and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048365 and Rac GTPase binding and molecular function this GO :0048538 and thymus development and biological process this GO :0048678 and response to axon injury and biological process this GO :0050665 and hydrogen peroxide biosynthetic process and biological process this GO :0051087 and chaperone binding and molecular function this GO :0051881 and regulation of mitochondrial membrane potential and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0060047 and heart contraction and biological process this GO :0060052 and neurofilament cytoskeleton organization and biological process this GO :0060087 and relaxation of vascular smooth muscle and biological process this GO :0060088 and auditory receptor cell stereocilium organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071276 and cellular response to cadmium ion and biological process this GO :0071318 and cellular response to ATP and biological process this GO :0072593 and reactive oxygen species metabolic process and biological process this GO :0097332 and response to antipsychotic drug and biological process this GO :1902177 and positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway and biological process, this GO :0004784: superoxide dismutase activity, this GO :0004784: superoxide dismutase activity and also this GO :0005507: copper ion binding and also this GO :0005515: protein binding and also this GO :0008270: zinc ion binding and also this GO :0019899: enzyme binding and also this GO :0030346: protein phosphatase 2B binding and also this GO :0042802: identical protein binding and also this GO :0042803: protein homodimerization activity and also this GO :0046872: metal ion binding and also this GO :0048365: Rac GTPase binding and also this GO :0051087: chaperone binding, this GO :0005507: copper ion binding, this GO :0005515: protein binding, this GO :0008270: zinc ion binding, this GO :0019899: enzyme binding, this GO :0030346: protein phosphatase 2B binding, this GO :0042802: identical protein binding, this GO :0042803: protein homodimerization activity, this GO :0046872: metal ion binding, this GO :0048365: Rac GTPase binding, this GO :0051087: chaperone binding, superoxide dismutase 1 |
| Identity | 11179 |
| Gene | SOD1 |
| Long gene name | superoxide dismutase 1 |
| Synonyms gene | ALS ALS1 |
| Synonyms gene name | amyotrophic lateral sclerosis 1 (adult) superoxide dismutase 1, soluble |
| Synonyms | IPOA |
| Locus | 21q22, 11 |
| Discovery year | 1986-01-01 |
| GenBank acession | AY049787 X02317 |
| Entrez gene record | 6647 |
| Pubmed identfication | 8446170 |
| RefSeq identity | NM_000454 |
| Havana BLAST/BLAT | OTTHUMG00000084878 |
| Locus Specific Databases | ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database LRG_652 |