Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His)

Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His) size: 50 µg 369

Price 369

Size 50 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Human
Source	proteins, Recombinants or rec
Description	Recombinant Human Thymopoietin is produced by our E, coli expression system and the target gene encoding Pro2-Glu187 is expressed with a 6His tag at the C-terminus
Molecular Weight	21, 6 kD
UniProt number	P42167
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNELEHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Properties	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group	recombinants
Gene	ERBIN
Gene target	LAP2 (C-6His), TMPO, Thymopoietin
Short name	LAP2 (C-6His), TMPO, Recombinant Thymopoietin
Technique	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Humans, Human
Alternative name	LAP2 (C-6His), TMPO, sapiens Thymopoietin, recombinant H
Alternative technique	rec
Identity	15842
Long gene name	erbb2 interacting protein
Synonyms gene	ERBB2IP
Synonyms gene name	erbb2-interacting protein
Synonyms	LAP2
Synonyms name	densin-180-like protein ERBB2-interacting protein
Locus	5q12, 3
Discovery year	2001-06-18
Entrez gene record	55914
Pubmed identfication	10574462 10878805
RefSeq identity	NM_018695
Classification	PDZ domain containing
Havana BLAST/BLAT	OTTHUMG00000097808

Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His)

Recombinant Human Thymopoietin, TMPO, LAP2 (C-6His) size: 50 µg 369

Similar products

Subscribe to our Newsletter