Technique
Supplier
Species
Label
Iso Type
Host
Tissue
Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)
Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His) size: 1 mg 2486
Supplier
NOVO
Price
2486
Size
1 mg
Contact us
Ask Component cell markers and DNA bp. markers are genetic markerser genes
or DNA sequenceswith
selection audit
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Tumor Necrosis Factor alpha is produced by our E, coli expression system and the target gene encoding Gly57-Leu233 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 21, 8 kD |
| UniProt number | P01375 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 100 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | (N-6His), TNF&alpha, Tumor Necrosis Factor &alpha |
| Short name | (N-6His), TNF&alpha, Recombinant Tumor Necrosis Factor &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | (N-6His), TNF&alpha, sapiens Tumor Necrosis Factor &alpha, recombinant H |
| Alternative technique | rec |
| Identity | 11892 |
| Gene | TNF |
| Long gene name | tumor necrosis factor |
| Synonyms gene | TNFA |
| Synonyms gene name | member 2) , tumor necrosis factor (TNF superfamily |
| Synonyms | TNFSF2 DIF TNF-alpha |
| Synonyms name | TNF superfamily, member 2 |
| Locus | 6p21, 33 |
| Discovery year | 1986-01-01 |
| GenBank acession | X02910 |
| Entrez gene record | 7124 |
| Pubmed identfication | 2413547 6392892 |
| Classification | Tumor necrosis factor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000031194 |
Similar products
- Recombinant Human Tumor Necrosis Factor α, TNFα
- Recombinant Human Tumor Necrosis Factor α, TNFα
- Recombinant Human Tumor Necrosis Factor α, TNFα
- Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant
- Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant
- Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant
- Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant
- Recombinant Human Tumor Necrosis Factor β, TNFβ
- Recombinant Human Tumor Necrosis Factor β, TNFβ
- Recombinant Human Tumor Necrosis Factor β, TNFβ
- Recombinant Human Tumor Necrosis Factor β, TNFβ
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)
- Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-Fc)
- Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (C-Fc-Avi)
- Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (C-Fc-Avi)
- Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (C-Fc-Avi)
- Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (C-Fc-Avi)
- Recombinant Human Tumor Necrosis Factor-alpha/TNFSF2 Protein
- Recombinant Human Tumor Necrosis Factor Receptor Type 1 His Tag
- Recombinant Human Tumor Necrosis Factor Receptor Type 1
- Recombinant Human Tumor Necrosis Factor Receptor Type 2