Technique
Supplier
Species
Label
Iso Type
Host
Tissue
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His) size: 50 µg 339
Supplier
NOVO
Price
339
Size
50 µg
Contact us
Ask Component cell markers and DNA bp. markers are genetic markerser genes
or DNA sequenceswith
selection audit
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight | 23, 3 kD |
| UniProt number | O00762 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MRGSHHHHHHGSMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | UBCH10 (N-6His), UBE2C, Ubiquitin-Conjugating E2 C |
| Short name | UBCH10 (N-6His), UBE2C, Recombinant Ubiquitin-Conjugating Enzyme E2 C |
| Technique | E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | UBCH10 (N-6His), UBE2C, sapiens Ubiquitin-Conjugating Enzyme E2 C, recombinant H |
| Alternative technique | rec |
| Identity | 15937 |
| Gene | UBE2C |
| Long gene name | ubiquitin conjugating enzyme E2 C |
| Synonyms gene name | ubiquitin-conjugating enzyme E2C |
| Synonyms | UBCH10 |
| Locus | 20q13, 12 |
| Discovery year | 2001-07-31 |
| GenBank acession | U73379 |
| Entrez gene record | 11065 |
| Pubmed identfication | 9122200 |
| RefSeq identity | NM_007019 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000033038 |
Similar products
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4, UBE2D4 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4, UBE2D4 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4, UBE2D4 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4, UBE2D4 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, UBE2H (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, UBE2H (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, UBE2H (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, UBE2H (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 T, UBE2T (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 T, UBE2T (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 T, UBE2T (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 T, UBE2T (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 S, UBE2S (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 S, UBE2S (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 S, UBE2S (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 S, UBE2S (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2, UBE2G2, UBC7 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2, UBE2G2, UBC7 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2, UBE2G2, UBC7 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2, UBE2G2, UBC7 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, UBE2J2 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, UBE2J2 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, UBE2J2 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, UBE2J2 (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2, UBE2V2, DDVIT1 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2, UBE2V2, DDVIT1 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2, UBE2V2, DDVIT1 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2, UBE2V2, DDVIT1 (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D3, UBE2D3
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D3, UBE2D3
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D3, UBE2D3
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D3, UBE2D3
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST)
- Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST)