| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight | 42, 9 kD |
| UniProt number | P51668 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 10% Glycerin pH7, 2 um filtered solution of 50 mM HEPES,150 mM sodium chloride,2 mM DTT, 5, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | UBE2D1, UbcH5a (N-GST), Ubiquitin-Conjugating E2 D1 |
| Short name | UBE2D1, UbcH5a (N-GST), Recombinant Ubiquitin-Conjugating Enzyme E2 D1 |
| Technique | E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | UBE2D1, UbcH5a (N-GST), sapiens Ubiquitin-Conjugating Enzyme E2 D1, recombinant H |
| Alternative technique | rec |
| Identity | 12474 |
| Gene | UBE2D1 |
| Long gene name | ubiquitin conjugating enzyme E2 D1 |
| Synonyms gene | SFT |
| Synonyms gene name | stimulator of Fe transport ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) ubiquitin-conjugating enzyme E2D 1 |
| Synonyms | UbcH5A UBCH5 UBC4/5 E2(17)KB1 |
| Locus | 10q21, 1 |
| Discovery year | 1997-03-21 |
| GenBank acession | BC015997 |
| Entrez gene record | 7321 |
| Pubmed identfication | 10072594 8530467 |
| RefSeq identity | NM_003338 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000018269 |