| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight | 18, 5 kD |
| UniProt number | Q15819 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | pH 7, 150 mM sodium chloride, 2 um filtered solution of 50 mM HEPES, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | DDVIT1 (N-6His), UBE2V2, Ubiquitin-Conjugating E2 Variant 2 |
| Short name | DDVIT1 (N-6His), UBE2V2, Recombinant Ubiquitin-Conjugating Enzyme E2 Variant 2 |
| Technique | E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | DDVIT1 (N-6His), UBE2V2, sapiens Ubiquitin-Conjugating Enzyme E2 Variant 2, recombinant H |
| Alternative technique | rec |
| Identity | 12495 |
| Gene | UBE2V2 |
| Long gene name | ubiquitin conjugating enzyme E2 V2 |
| Synonyms gene name | ubiquitin-conjugating enzyme E2 variant 2 |
| Synonyms | UEV-2 DDVit-1 EDPF-1 MMS2 UEV2 EDPF1 DDVIT1 EDAF-1 |
| Locus | 8q11, 21 |
| Discovery year | 1998-08-25 |
| GenBank acession | X98091 |
| Entrez gene record | 7336 |
| Pubmed identfication | 9418904 9199207 |
| RefSeq identity | NM_003350 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000164206 |