Name : Recombinant Human Xaa-Pro Aminopeptidase P3, XPNPEP3 (N, C-6His)
Supplier : NOVO
Price :202
SKU : GEN5245511442
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the C-terminus, Recombinant Human Aminopeptidase P3 is produced by our E, coli expression system and the target gene encoding Met1-Ser507 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 2 kD, 60 |
| UniProt number | Q9NQH7 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 1 mM DTT, pH 7, 2 um filtered solution of 25 mM Tris, 3, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPFILSADCPKEMNDIEQICSQASLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | C-6His), XPNPEP3 (N, Xaa-Pro Aminopeptidase P3 |
| Short name | C-6His), XPNPEP3 (N, Recombinant Xaa-Pro Aminopeptidase P3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | C-6His), XPNPEP3 (N, sapiens Xaa-L-proline Aminopeptidase P3, recombinant H |
| Alternative technique | rec |
| Identity | 28052 |
| Gene | XPNPEP3 |
| Long gene name | X-prolyl aminopeptidase 3 |
| Synonyms gene name | X-prolyl aminopeptidase (aminopeptidase P) 3, mitochondrial , putative X-prolyl aminopeptidase 3 |
| Synonyms | APP3 NPHPL1 ICP55 |
| Synonyms name | Intermediate Cleaving Peptidase 55 |
| Locus | 22q13, 2 |
| Discovery year | 2006-08-02 |
| Entrez gene record | 63929 |
| Pubmed identfication | 15708373 20179356 24116217 |
| RefSeq identity | NM_022098 |
| Classification | Aminopeptidases |
| Havana BLAST/BLAT | OTTHUMG00000151312 |