Recombinant Mouse B7-1, CD80 (C-6His)

Recombinant Mouse B7-1, CD80 (C-6His) size: 50 µg 141

Price 141

Size 50 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Mouse
Source	proteins, Recombinants or rec
Description	Recombinant Mouse T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target gene encoding Val38-Asn246 is expressed with a 6His tag at the C-terminus
Molecular Weight	24, 6 kD
UniProt number	Q00609
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Test	A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or
Latin name	Mus musculus
Group	recombinants
Gene target	CD80 (C-6His), B7-1
Short name	CD80 (C-6His), Recombinant Mouse B7-1
Technique	E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Mouses, Mouse
Alternative name	CD80 molecule (C-6His), recombinant Mouse B7-1
Alternative technique	rec
Alternative to gene target	B7 and B7-1 and B7, BT, CD80 and IDBG-51287 and ENSG00000121594 and 941, Cd80 and IDBG-160288 and ENSMUSG00000075122 and 12519, Cell surfaces, DNA-templated and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process, coreceptor activity, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009967 and positive regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045425 and positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process and biological process this GO :0045627 and positive regulation of T-helper 1 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0015026: coreceptor activity, this GO :0015026: coreceptor activity, 1 and BB1 and CD28LG and CD28LG1 and LAB7, 27986 and IDBG-632750 and ENSBTAG00000018059 and 407131, CD80 molecule
Identity	1700
Gene	CD80
Long gene name	CD80 molecule
Synonyms gene	CD28LG CD28LG1
Synonyms gene name	B7-1 antigen) CD80 molecule , CD80 antigen (CD28 antigen ligand 1
Synonyms	B7, 1 B7-1
Synonyms name	B-lymphocyte activation antigen B7
Locus	3q13, 33
Discovery year	1993-12-14
Entrez gene record	941
Pubmed identfication	1370389
RefSeq identity	NM_005191
Classification	C2-set domain containing CD molecules V-set domain containing
Havana BLAST/BLAT	OTTHUMG00000159419

Recombinant Mouse B7-1, CD80 (C-6His)

Recombinant Mouse B7-1, CD80 (C-6His) size: 50 µg 141

Similar products

Subscribe to our Newsletter