Name : Recombinant Mouse Betacellulin, BTC (N-6His)
Supplier : NOVO
Price :2283
SKU : GEN5389268213
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Betacellulin is produced by our E, coli expression system and the target gene encoding Asp32-Gln118 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 12, 2 kD |
| UniProt number | Q543J8 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMDGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | BTC (N-6His), Betacellulin |
| Short name | BTC (N-6His), Recombinant Mouse Betacellulin |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | betacellulin (N-6His), recombinant Mouse Betacellulin |
| Alternative technique | rec |
| Alternative to gene target | BTC and IDBG-24477 and ENSG00000174808 and 685, BTC and IDBG-643041 and ENSBTAG00000004237 and 280737, Btc and IDBG-394187 and ENSMUSG00000082361 and 12223, Extracellular, growth factor activity, this GO :0005154 and epidermal growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0035810 and positive regulation of urine volume and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0051781 and positive regulation of cell division and biological process, this GO :0005154: epidermal growth factor receptor binding, this GO :0005154: epidermal growth factor receptor binding and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity, this GO :0005515: protein binding, this GO :0008083: growth factor activity, betacellulin |
| Identity | 1121 |
| Gene | BTC |
| Long gene name | betacellulin |
| Locus | 4q13, 3 |
| Discovery year | 1994-07-21 |
| GenBank acession | S55606 |
| Entrez gene record | 685 |
| Pubmed identfication | 8439318 11522793 |
| Havana BLAST/BLAT | OTTHUMG00000130107 |