Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc)

Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc) size: 500 µg 1613

Price 1613

Size 500 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Mouse
Source	proteins, Recombinants or rec
Description	Recombinant Mouse Ephrin A3 is produced by our Mammalian expression system and the target gene encoding Gln23-Gly206 is expressed with a Fc tag at the C-terminus
Molecular Weight	47, 9 kD
UniProt number	O08545
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Test	A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or
Latin name	Mus musculus
Group	recombinants
Gene target	EFNA3 (C-Fc), Ephrin-A3
Short name	EFNA3 (C-Fc), Recombinant Mouse Ephrin-A3
Technique	E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Mouses, Mouse
Alternative name	EFNA3 (C-fragment c), recombinant Mouse Ephrin-A3
Alternative technique	rec
Identity	3223
Gene	EFNA3
Long gene name	ephrin A3
Synonyms gene	EPLG3
Synonyms gene name	ephrin-A3
Synonyms	LERK3 Ehk1-L
Locus	1q21, 3
Discovery year	1995-01-17
GenBank acession	BC017722
Entrez gene record	1944
Pubmed identfication	8660976
RefSeq identity	NM_004952
Classification	Ephrins
Havana BLAST/BLAT	OTTHUMG00000035313

Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc)

Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc) size: 500 µg 1613

Similar products

Subscribe to our Newsletter