Filters

Recombinant Mouse Interleukin-23, IL-23

Recombinant Mouse Interleukin-23, IL-23 size: 1 mg 3602

Supplier NOVO
Price 3602
Size 1 mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
Reacts withMouse
Source proteins, Recombinants or rec
DescriptionMet23-Ser335 is expressed, Recombinant Mouse Interleukin-23 is produced by our Mammalian expression system and the target gene encoding Val22-Ala196&
Molecular Weight19, 35, 7&, 8 kD
UniProt numberP43432, Q9EQ14&
State of the productFreeze-dried
Shipping conditionsAmbient temperature
Formulation pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to_x005F_x0006_࢟࢟_x005F_x0005__x005F_x0006_ࢠࢠ_x005F_x0005__x005F_x0006_࢞࢞_x005F_x000F__x005F_x000F_, Always centrifuge tubes before opening, g/ml, ࠘耀
Purity and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acidMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS, VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&
Levels of endotoxin11 IEU/ug, LAL test shows less than than 0
Test A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin nameMus musculus
Grouprecombinants
Gene target IL-23, Interleukin-23
Short name IL-23, Recombinant Mouse Interleukin-23
Technique E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species Mouses, Mouse
Alternative name Interleukin-23, recombinant Mouse Interleukin-23
Alternative techniquerec
Identity 15488
Gene IL23A
Long gene name interleukin 23 subunit alpha
Synonyms gene name alpha subunit p19 , interleukin 23
Synonyms SGRF IL23P19 IL-23 IL-23A P19
Synonyms name G-CSF related factor , interleukin-six
Locus 12q13, 3
Discovery year 2001-04-10
GenBank acession AB030000
Entrez gene record 51561
Pubmed identfication 11114383
RefSeq identity NM_016584
Classification Interleukins
Havana BLAST/BLAT OTTHUMG00000187402

Similar products

Subscribe to our Newsletter