Recombinant Mouse M-CSF, CSF1

Recombinant Mouse M-CSF, CSF1 size: 1 mg 2486

Price 2486

Size 1 mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Mouse
Source	proteins, Recombinants or rec
Description	Recombinant Mouse Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Lys33-Glu262 is expressed
Molecular Weight	26 kD
UniProt number	P07141
State of the product	Freeze-dried
Shipping conditions	Ambient temperature
Formulation	pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLEVDHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Test	A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or
Latin name	Mus musculus
Group	recombinants
Gene target	CSF1, M-CSF
Short name	CSF1, Recombinant Mouse M-CSF
Technique	E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Mouses, Mouse
Alternative name	colony stimulating factor 1 (macrophage), recombinant Mouse M-CSF
Alternative technique	rec
Alternative to gene target	CSF-1 and MCSF, CSF1 and IDBG-100920 and ENSG00000184371 and 1435, CSF1 and IDBG-635251 and ENSBTAG00000000283 and 281094, Csf1 and IDBG-185535 and ENSMUSG00000014599 and 12977, Extracellular, protein homodimerization activity, this GO :0001503 and ossification and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002158 and osteoclast proliferation and biological process this GO :0003006 and developmental process involved in reproduction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005157 and macrophage colony-stimulating factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010743 and regulation of macrophage derived foam cell differentiation and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030097 and hemopoiesis and biological process this GO :0030154 and cell differentiation and biological process this GO :0030225 and macrophage differentiation and biological process this GO :0030278 and regulation of ossification and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032946 and positive regulation of mononuclear cell proliferation and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042117 and monocyte activation and biological process this GO :0042476 and odontogenesis and biological process this GO :0042488 and positive regulation of odontogenesis of dentin-containing tooth and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045657 and positive regulation of monocyte differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0060611 and mammary gland fat development and biological process this GO :0060763 and mammary duct terminal end bud growth and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity and also this GO :0005157: macrophage colony-stimulating factor receptor binding and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity and also this GO :0042803: protein homodimerization activity, this GO :0005157: macrophage colony-stimulating factor receptor binding, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0042803: protein homodimerization activity, colony stimulating factor 1 (macrophage)
Identity	2432
Gene	CSF1
Long gene name	colony stimulating factor 1
Synonyms gene name	colony stimulating factor 1 (macrophage)
Synonyms	M-CSF MCSF MGC31930
Synonyms name	macrophage colony stimulating factor 1
Locus	1p13, 3
Discovery year	1986-01-01
GenBank acession	BC021117
Entrez gene record	1435
Pubmed identfication	1540160
RefSeq identity	NM_000757
Havana BLAST/BLAT	OTTHUMG00000011646

Recombinant Mouse M-CSF, CSF1

Recombinant Mouse M-CSF, CSF1 size: 1 mg 2486

Similar products

Subscribe to our Newsletter