Filters

SAFB Antibody / Scaffold attachment factor B1

SAFB Antibody / Scaffold attachment factor B1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenSAFB / Scaffold attachment factor B1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis SAFB antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q15424
PurityAntigen affinity
Description Complex subunit associated factors are involved in hybridoma growth, Eosinohils, NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation, Aplha
ImmunogenAmino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SAFB antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetSAFB / Scaffold attachment factor B1
Short nameSAFB Antibody / Scaffold attachment factor B1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameSAFB (Antibody to) / Scaffold attachment factor B1
Alternative techniqueantibodies
Identity 10520
Gene SAFB
Long gene name scaffold attachment factor B
Synonyms HET SAFB1
Synonyms name Hsp27 ERE-TATA binding protein
Locus 19p13, 3
Discovery year 1998-01-27
GenBank acession L43631
Entrez gene record 6294
Pubmed identfication 9605873 8600450
Classification RNA binding motif containing
Havana BLAST/BLAT OTTHUMG00000180502

Similar products

Subscribe to our Newsletter