Filters

Sp5 Antibody

Sp5 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenSp5
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the Sp5 antibody should be determined by the researcher
Intented useThis Sp5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q6BEB4
PurityAntigen affinity
Description Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, It is a member of the Sp family of zinc finger transcription factors, Like other family members, gastric cancer and colon cancer, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus, 1, Sp5 is mapped to 2q31
ImmunogenAmino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Sp5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetSp5
Short nameSp5 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameSp5 (Antibody to)
Alternative techniqueantibodies
Identity 14529
Gene SP5
Long gene name Sp5 transcription factor
Locus 2q31, 1
Discovery year 2004-06-09
Entrez gene record 389058
RefSeq identity XM_371581
Classification Sp transcription factors Zinc fingers C2H2-type
Havana BLAST/BLAT OTTHUMG00000154053

Similar products

Subscribe to our Newsletter