Filters

Talin 2 Antibody / TLN2

Talin 2 Antibody / TLN2 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenTalin 2 / TLN2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0
NotesOptimal dilution of the Talin 2 antibody should be determined by the researcher
Intented useThis Talin 2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9Y4G6
PurityAntigen affinity
Description It belongs to the talin protein family, Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally, This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts, Talin 2 is a protein in humans that is encoded by the TLN2 gene
ImmunogenAmino acids NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV were used as the immunogen for the Talin 2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Talin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membranous, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetTalin 2 / TLN2
Short nameTalin 2 Antibody / TLN2
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameTalin 2 (Antibody to) / talin 2
Alternative techniqueantibodies
Alternative to gene target Cell surfaces, TLN2 and IDBG-15260 and ENSG00000171914 and 83660, TLN2 and IDBG-646546 and ENSBTAG00000003667 and 528252, Tln2 and IDBG-180368 and ENSMUSG00000052698 and 70549, actin filament binding, this GO :0001726 and ruffle and cellular component this GO :0003779 and actin binding and molecular function this GO :0005158 and insulin receptor binding and molecular function this GO :0005198 and structural molecule activity and molecular function this GO :0005200 and structural constituent of cytoskeleton and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0005916 and fascia adherens and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007016 and cytoskeletal anchoring at plasma membrane and biological process this GO :0007043 and cell-cell junction assembly and biological process this GO :0007155 and cell adhesion and biological process this GO :0015629 and actin cytoskeleton and cellular component this GO :0045202 and synapse and cellular component this GO :0051015 and actin filament binding and molecular function, this GO :0003779: actin binding, this GO :0003779: actin binding and also this GO :0005158: insulin receptor binding and also this GO :0005198: structural molecule activity and also this GO :0005200: structural constituent of cytoskeleton and also this GO :0005515: protein binding and also this GO :0051015: actin filament binding, this GO :0005158: insulin receptor binding, this GO :0005198: structural molecule activity, this GO :0005200: structural constituent of cytoskeleton, this GO :0005515: protein binding, this GO :0051015: actin filament binding, talin 2
Identity 15447
Gene TLN2
Long gene name talin 2
Synonyms KIAA0320 ILWEQ
Locus 15q22, 2
Discovery year 2001-04-25
GenBank acession AB002318
Entrez gene record 83660
Pubmed identfication 9205841 11527381
Classification FERM domain containing
Havana BLAST/BLAT OTTHUMG00000133679

Similar products

Subscribe to our Newsletter