Filters

Tyrosine Hydroxylase Antibody / TH

Tyrosine Hydroxylase Antibody / TH size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenTyrosine Hydroxylase / TH
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the Tyrosine Hydroxylase antibody should be determined by the researcher
Intented useThis Tyrosine Hydroxylase antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P07101
PurityAntigen affinity
Description Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, In humans, It is the rate-limiting enzyme in the synthesis of catecholamines, Mutations in this gene have been associated with autosomal recessive Segawa syndrome, The protein encoded by this gene is involved in the conversion of tyrosine to dopamine, Tyrosine hydroxylase, and the enzyme is present in the central nervous system (CNS), hence plays a key role in the physiology of adrenergic neurons, peripheral sympathetic neurons and the adrenal medulla, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs), tyrosine hydroxylase is encoded by the TH gene, TH is equal to tyrosine hydroxylase
ImmunogenAmino acids KVPWFPRKVSELDKCHHLVTKFDPDLDLDH of human TH were used as the immunogen for the Tyrosine Hydroxylase antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Tyrosine Hydroxylase antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetTyrosine Hydroxylase / TH
Short nameTyrosine Hydroxylase Antibody / TH
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameTyrosine Hydroxylase (Antibody to) / TH
Alternative techniqueantibodies

Similar products

Subscribe to our Newsletter