Filters

UBA1 Antibody

UBA1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenUBA1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the UBA1 antibody should be determined by the researcher
Intented useThis UBA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P22314
PurityAntigen affinity
Description Additionally, DNA damage repair, It also continues to participate in subsequent steps of ubiquination as a Ub carrier, Specifically, The protein encoded by this gene catalyzes the first step in ubiquitin conjugation, Through its central role in ubiquitination, UBA1 catalyzes the ATP-dependent adenylation of ubiquitin (Ub), UBA1 has been linked to cell cycle regulation, UBA1 is one of only two human ubiquitin-activating enzymes (E1), UBE1 helps regulate the NEDD8 pathway, and thus is largely responsible for protein ubiquitination in humans, and transcriptional regulation, apoptosis, as well as mitigating the depletion of ubiquitin levels during stress, endocytosis, or ubiquitination, signal transduction, the other being UBA6, thereby forming a thioester bond between the two, thus implicating it in protein folding, to mark cellular proteins for degradation, Ubiquitin-like modifier activating enzyme 1 (UBA1) is an enzyme which in humans is encoded by the UBA1 gene
ImmunogenAmino acids HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN of human UBA1 were used as the immunogen for the UBA1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UBA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetUBA1
Short nameUBA1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameUBA1 (Antibody to)
Alternative techniqueantibodies
Identity 12469
Gene UBA1
Long gene name ubiquitin like modifier activating enzyme 1
Synonyms gene A1S9T GXP1 UBE1
Synonyms gene name ubiquitin-activating enzyme E1 (A1S9T and BN75 temperature sensitivity complementing) ubiquitin-activating enzyme E1 ubiquitin-like modifier activating enzyme 1
Synonyms UBE1X POC20 CFAP124
Synonyms name UBA1, ubiquitin-activating enzyme E1 homolog (yeast) POC20 centriolar protein homolog (Chlamydomonas)
Locus Xp11, 3
Discovery year 1991-07-11
GenBank acession AF258566
Entrez gene record 7317
Pubmed identfication 1845793
RefSeq identity NM_003334
Classification Ubiquitin like modifier activating enzymes
Havana BLAST/BLAT OTTHUMG00000021436
Locus Specific Databases Mental Retardation database

Similar products

Subscribe to our Newsletter