Product Listing

GEN7204096808 COX1 - PTGS1 Lentiviral Vector (Rat) (pLenti-III-HA) ABM LENTIVECTORS 1.0 µg DNA 322 €

GEN3323402663 PSD95 Lentiviral Vector (Rat) (pLenti-His) ABM LENTIVECTORS 1.0 µg DNA 322 €

GEN2667050797 Synaptophysin Lentiviral Vector (Rat) (pLenti-His) ABM LENTIVECTORS 1.0 µg DNA 322 €

GEN9753394150 Lactoferrin, Human milk (>95% pure; iron saturated) ADI 1 mg 333 €

GEN7781968210 Mouse monoclonal Anti-rat/mouse lactoferrin IgG ADI 100 μL 565 €

GEN2972852795 Electrode filling solution Saturated Potassium KCI, free from Silver ion REAGECO 1L 214 €

GEN8352843760 Electrode filling solution Saturated Potassium KCI, free from Silver ion REAGECO 100ml 97 €

GEN2155174747 Lethal factor Protease Substrate 3, AMC derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) ADI 1 mg 478 €

GEN8711570930 Lethal factor Protease Substrate 2, pNA derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) ADI 1 mg 478 €

GEN2594211882 Lethal factor Protease Substrate 1, Internally quenched Coumarin peptide substrate for monitoring LF protease activity (19aa) ADI 500 μg 623 €

GEN5944283269 Rat Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein ADI 50 μg 478 €

GEN7423683867 Rat Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein ADI 10 μg 188 €

GEN1748896115 Rat Recombinant (E.Coli) Purified Leptin Protein ADI 5 mg 1058 €

GEN7142698970 Rat Recombinant (E.Coli) Purified Leptin Protein ADI 1 mg 333 €

GEN8183494257 Rat Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody positive control serum ADI 1 mL 260 €

GEN3280994777 Rat Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody negative control serum ADI 1 mL 188 €

GEN8016422658 UroDetect Drugs of Abuse control Panel for IVD II-Barbiturates NATROLS AND VIRAL DIAGNOSTIC ANTIGENS 10 specimens 0.5 mL 462 €

GEN3324432600 Rat Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody positive control serum ADI 1 mL 260 €

GEN9910427356 Rat Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody negative control serum ADI 1 mL 188 €

GEN5322856635 Rat Osteopontin ELISA kit KAMIYA 96 well plate 548 €

GEN9663522743 Rat Caveolin 1 (CAV1) ELISA kit KAMIYA 96 well plate 1193 €

GEN3904897730 Human Carbohydrate Antigen 72-4 (CA72-4) ELISA kit KAMIYA 96 well plate 1113 €

GEN1234924113 Rat Calcitonin (CT) ELISA kit KAMIYA 96 well plate 1193 €

GEN6214326778 Rat Brain Natriuretic Peptide (BNP) ELISA kit KAMIYA 96 well plate 1193 €

GEN7276241295 Rat Brain Derived Neurotrophic Factor ELISA kit KAMIYA 96 well plate 1193 €

GEN9776208375 Rat ANP ELISA kit KAMIYA 96 well plate 1193 €

GEN7639622371 Rat Mesenteric Adipocyte Culture Kit KAMIYA 1 kit 1992 €

GEN8166449270 Rat Subcutaneous Adipocyte Culture Kit KAMIYA 1 kit 1708 €

GEN4958045751 Rat Epididymal Adipocyte Culture Kit KAMIYA 1 kit 1992 €

GEN8717980184 Rat Aspartate Aminotransferase (AST) ELISA kit KAMIYA 96 well plate 1193 €

GEN2650266638 Rat IgG2b ELISA kit KAMIYA 96 well plate 548 €

GEN6639414205 Rat IgG2a ELISA kit KAMIYA 96 well plate 548 €

GEN3989270861 Rat IgG1 ELISA kit KAMIYA 96 well plate 548 €

GEN2769172374 Vitamin C Calibrator KAMIYA 6 x 1 mL 143 €

GEN8536980198 Rat APOA1 ELISA kit KAMIYA 96 well plate 1193 €

GEN5755206541 Rat Triiodothyronine (T3) ELISA kit KAMIYA 96 well plate 1068 €

GEN6655488818 Rat Pentraxin 3 (PTX3) ELISA kit KAMIYA 96 well plate 1068 €

GEN1825422750 Osteoclast (Rat) Culture Kit / Bone Resorption KAMIYA 1 kit 1903 €

GEN9358036559 Mouse and Rat SP-D ELISA kit KAMIYA 96 well plate 1393 €

GEN3911617368 Rat Anti-PEG IgG ELISA kit KAMIYA 96 well plate 748 €

GEN7450531879 Rat Anti-PEG IgM ELISA kit KAMIYA 96 well plate 748 €

GEN4931510082 Rat Anti-DNP IgM ELISA kit KAMIYA 96 well plate 748 €

GEN9197263975 Rat Anti-DNP IgG ELISA kit KAMIYA 96 well plate 748 €

GEN9449318033 Rat TNF-alpha ELISA kit KAMIYA 96 well plate 523 €

GEN2124161920 Rat Prolactin ELISA kit KAMIYA 96 well plate 1058 €

GEN5600352009 Rat Angiotensin II (AngII) ELISA kit KAMIYA 96 well plate 1193 €

GEN1515088556 Rat Ang-I ELISA kit KAMIYA 96 well plate 1193 €

GEN9811788494 Rat Angiotensin I Converting Enzyme (ACE) ELISA kit KAMIYA 96 well plate 1193 €

GEN4716792908 Rat ACE2 ELISA kit KAMIYA 96 well plate 1193 €

GEN1432936581 Rat ANGPT2 ELISA kit KAMIYA 96 well plate 1193 €

GEN5682685271 Rat ANG1 ELISA kit KAMIYA 96 well plate 1193 €

GEN5638805548 Rat Primary Precursor Osteoclasts Culture Kit with Osteoplate KAMIYA 4 x 10^6 cells 1443 €

GEN2102077700 Rat Primary Precursor Osteoclasts Culture Kit with Osteoplate KAMIYA 8 x 10^6 cells 2138 €

GEN1833367467 Rat Cardiac Troponin-I, High Sensitive ELISA kit KAMIYA 96 well plate 648 €

GEN2208231974 Rat GST Yb1 ELISA kit KAMIYA 96 well plate 548 €

GEN2896870074 Rat Alpha Glutathione S-Transferase ELISA kit KAMIYA 96 well plate 548 €

GEN5907822982 Mouse/Rat Urocortin 1 ELISA kit Kit KAMIYA 96 well plate 1131 €

GEN6230588647 Rat L-FABP ELISA kit KAMIYA 96 well plate 518 €

GEN4351452876 Bovine IgG ELISA kit, No Crossreactivity with Mouse, Rat, Rabbit, or Human IgG KAMIYA 96 well plate 548 €

GEN2956028553 Rat KIM1 ELISA kit KAMIYA 96 well plate 561 €

GEN4348360228 Rat Alkaline Phosphatase (ALP) ELISA kit KAMIYA 96 well plate 1193 €

GEN8999952903 Rat Alanine Aminotransferase (ALT) ELISA kit KAMIYA 96 well plate 1193 €

GEN8521881658 Rat TAR DNA Binding Protein 43 (TDP43) ELISA kit KAMIYA 96 well plate 1091 €

GEN3878337358 Rat Vasoactive Intestinal Peptide (VIP) ELISA kit KAMIYA 96 well plate 1091 €

GEN1295034715 Rat Vascular Cell Adhesion Molecule 1 (VCAM-1) ELISA kit KAMIYA 96 well plate 1091 €

GEN8307509551 Rat Tartrate Resistant Acid Phosphatase 5b (TRACP5b) ELISA kit KAMIYA 96 well plate 1091 €

GEN3921374203 Rat Tissue Factor Pathway Inhibitor (TFPI) ELISA kit KAMIYA 96 well plate 1091 €

GEN7476589893 Rat Troponin C Type 2 Fast (TNNC2) ELISA kit KAMIYA 96 well plate 1091 €

GEN2672916109 Rat Thrombomodulin ELISA kit KAMIYA 96 well plate 1091 €

GEN9048463958 Rat Thyroxine (T4) ELISA kit KAMIYA 96 well plate 1091 €

GEN2157252292 Rat TF ELISA kit KAMIYA 96 well plate 1091 €

GEN9927878155 Rat Cardiac Troponin T (cTnT) ELISA kit KAMIYA 96 well plate 1091 €

GEN9851874046 Rat Testosterone ELISA kit KAMIYA 96 well plate 1091 €

GEN2898177371 Rat Selenoprotein P1 (SEPP1) ELISA kit KAMIYA 96 well plate 1091 €

GEN2780350747 Rat S100B ELISA kit KAMIYA 96 well plate 1091 €

GEN1685089283 Rat sVEGFR1 ELISA kit KAMIYA 96 well plate 1091 €

GEN1424019771 Rat rT3 ELISA kit KAMIYA 96 well plate 1091 €

GEN8058969494 Rat Renin ELISA kit KAMIYA 96 well plate 1091 €

GEN9768575699 Rat ?2 Macroglobulin Precursor (P?2MG) ELISA kit KAMIYA 96 well plate 1091 €

GEN8071733741 Rat Procollagen III N Terminal Propeptide (PIIINP) ELISA kit KAMIYA 96 well plate 1091 €

GEN8579094428 Rat Progesterone ELISA kit KAMIYA 96 well plate 1091 €

GEN1623691350 Rat Soluble P-Selectin ELISA kit KAMIYA 96 well plate 1091 €

GEN8251932700 Rat Ornithine Carbamoyl Transferase ELISA kit KAMIYA 96 well plate 1091 €

GEN8133171540 Rat NAG ELISA kit KAMIYA 96 well plate 1091 €

GEN3656364967 Rat Methemoglobin (MHB) ELISA kit KAMIYA 96 well plate 1091 €

GEN1894665489 Rat Myeloperoxidase (MPO) ELISA kit KAMIYA 96 well plate 1091 €

GEN2160969996 Rat Matrix Metalloproteinase 3 (MMP-3) ELISA kit KAMIYA 96 well plate 1091 €

GEN3997792911 Rat IGFBP-1 ELISA kit KAMIYA 96 well plate 1091 €

GEN2915297316 Rat Interleukin 8 (IL-8) ELISA kit KAMIYA 96 well plate 1091 €

GEN4344986994 Rat Indoxyl Sulfate (IS) ELISA kit KAMIYA 96 well plate 1091 €

GEN7514449234 Rat IKBa ELISA kit KAMIYA 96 well plate 1091 €

GEN5526890432 Rat HCY ELISA kit KAMIYA 96 well plate 1091 €

GEN8214088405 Rat Glycated Albumin (GALB) ELISA kit KAMIYA 96 well plate 1091 €

GEN5786734744 Rat/Mouse Adiponectin ELISA kit Kit KAMIYA 96 well plate 1131 €

GEN4223373373 Rat Free Thyroxine (FT4) ELISA kit KAMIYA 96 well plate 1091 €

GEN7396638346 Rat Free Triiodothyronine (FT3) ELISA kit KAMIYA 96 well plate 1091 €

GEN9617192943 Rat FIX ELISA kit KAMIYA 96 well plate 1091 €

GEN8895372954 Rat Follicle Stimulating Hormone ELISA kit KAMIYA 96 well plate 1091 €

GEN3366868840 Rat Deoxypyridinoline (DPD) ELISA kit KAMIYA 96 well plate 1091 €

GEN6584554225 Rat Connective Tissue Growth Factor (CTGF) ELISA kit KAMIYA 96 well plate 1091 €

GEN4262554344 Rat Cartilage Oligomeric Matrix Protein (COMP) ELISA kit KAMIYA 96 well plate 1091 €

GEN9408168314 Rat proBNP ELISA kit KAMIYA 96 well plate 1091 €

GEN9442100961 Rat Bone Alkaline Phosphatase (BALP) ELISA kit KAMIYA 96 well plate 1091 €

GEN1963194209 Rat Aldosterone ELISA kit KAMIYA 96 well plate 1091 €

GEN4724490244 Rat ACE2 ELISA kit KAMIYA 96 well plate 1091 €

GEN2675088928 Rat 5 Nucleotidase (5-NT) ELISA kit KAMIYA 96 well plate 1091 €

GEN6950581868 Rat ATP ELISA kit KAMIYA 96 well plate 1091 €

GEN1145132200 Mouse Tartrate Resistant Acid Phosphatase 5b (TRACP5b) ELISA kit KAMIYA 96 well plate 1074 €

GEN1145033582 Rat Retinol Binding Protein ELISA kit KAMIYA 96 well plate 548 €

GEN7326918172 Mouse and Rat Prolactin ELISA kit KAMIYA 96 well plate 1783 €

GEN6242630441 Rat Anti-Tetanus Toxoid IgG KAMIYA 96 well plate 748 €

GEN8726672799 Rat Anti-Tetanus Toxoid IgM KAMIYA 96 well plate 748 €

GEN6297000001 Rat Anti-SRBC IgG KAMIYA 96 well plate 748 €

GEN6331017444 Rat Anti-SRBC IgM KAMIYA 96 well plate 748 €

GEN8912067171 Rat Anti-KLH IgG with controls KAMIYA 96 well plate 798 €

GEN8649372135 Rat Anti-KLH IgG KAMIYA 96 well plate 748 €

GEN5838351427 Rat Anti-KLH IgM with controls KAMIYA 96 well plate 798 €

GEN2159462493 Rat Anti-KLH IgM KAMIYA 96 well plate 748 €

GEN7617682460 Rat CK-MM ELISA kit KAMIYA 96 well plate 648 €

GEN3886221486 Rat Clusterin ELISA kit KAMIYA 96 well plate 523 €

GEN6729709000 Rat Cystatin C ELISA kit KAMIYA 96 well plate 548 €

GEN2216017620 Rat Beta 2-Microglobulin ELISA kit KAMIYA 96 well plate 548 €

GEN7479436572 Rat ACP5 ELISA kit KAMIYA 96 well plate 1193 €

GEN7964537842 Rat NGAL ELISA kit KAMIYA 96 well plate 548 €

GEN6091795754 Rat Reference Serum 2 KAMIYA 1 mL 253 €

GEN4278533885 Rat Vitamin D Binding Protein ELISA kit KAMIYA 96 well plate 548 €

GEN7694130320 Rat Intestinal Trefoil Factor 3 (TFF3) ELISA kit KAMIYA 96 well plate 1091 €

GEN7156736035 Rat TM ELISA kit KAMIYA 96 well plate 1091 €

GEN1112139777 Rat Tamm Horsfall Protein ELISA kit KAMIYA 96 well plate 1091 €

GEN1750301570 Rat Serum Amyloid A (SAA) ELISA kit KAMIYA 96 well plate 1091 €

GEN9508541022 Rat Podocalyxin ELISA kit KAMIYA 96 well plate 1091 €

GEN1310039833 Rat Platelet Factor 4 ELISA kit KAMIYA 96 well plate 1091 €

GEN1732029287 Rat PAI-1 ELISA kit KAMIYA 96 well plate 1091 €

GEN6245697224 Rat PTH ELISA kit KAMIYA 96 well plate 1091 €

GEN9291583413 Rat Osteocalcin (OC) ELISA kit KAMIYA 96 well plate 1091 €

GEN6152527439 Rat Interferon ? Antibody (IFN?Ab) ELISA kit KAMIYA 96 well plate 1091 €

GEN2590257610 Rat Glutathione S Transferase Alpha 1 ELISA kit KAMIYA 96 well plate 1091 €

GEN8290284110 Rat Gamma Glutamyltransferase 1 ELISA kit KAMIYA 96 well plate 1091 €

GEN6321485332 Rat E-selectin ELISA kit KAMIYA 96 well plate 1091 €

GEN3881630107 Rat E2 Estradiol ELISA kit KAMIYA 96 well plate 1091 €

GEN3019723992 Rat COMP ELISA kit KAMIYA 96 well plate 1091 €

GEN4153635104 Rat Calcitonin (CT) ELISA kit KAMIYA 96 well plate 1091 €

GEN5260661710 Rat Angiotensin I Converting Enzyme (ACE) ELISA kit KAMIYA 96 well plate 1091 €

GEN4276538963 Rat Angiotensin I Converting Enzyme 2 (ACE2) ELISA kit KAMIYA 96 well plate 1091 €

GEN7859584846 Mouse and Rat Corticosterone ELISA kit KAMIYA 96 well plate 1131 €

GEN9922701464 Mouse and Rat Obestatin ELISA kit KAMIYA 96 well plate 1131 €

GEN2012727851 Rat Urocortin 2 ELISA kit KAMIYA 96 well plate 1131 €

GEN8152205387 Rat and Mouse Skeletal Muscle Myosin Light Chain-1 ELISA kit KAMIYA 96 well plate 593 €

GEN4422627709 Rat and Mouse Cardiac Myosin Light Chain-1 ELISA kit KAMIYA 96 well plate 593 €

GEN5681508867 Rat Skeletal Muscle Troponin-1 ELISA kit KAMIYA 96 well plate 793 €

GEN7898604829 Rat Gc-Globulin ELISA kit KAMIYA 96 well plate 593 €

GEN5795375696 Rat Cardiac Troponin-I ELISA kit KAMIYA 96 well plate 593 €

GEN9170338761 Rat H-FABP ELISA kit KAMIYA 96 well plate 593 €

GEN4633147966 Rat Cardiac Troponin-I ELISA kit KAMIYA 96 well plate 593 €

GEN2668356961 Rat Plasminogen ELISA kit KAMIYA 96 well plate 498 €

GEN4732601163 Rat Hemoglobin ELISA kit KAMIYA 96 well plate 498 €

GEN1722718681 Rat CINC-1 ELISA kit KAMIYA 96 well plate 1268 €

GEN6203999027 Rat Beta2-Microglobulin ELISA kit KAMIYA 96 well plate 1543 €

GEN2422808995 Rat Leptin ELISA kit KAMIYA 96 well plate 1024 €

GEN8458604253 Rat Murinoglobulin ELISA kit KAMIYA 96 well plate 523 €

GEN8625399212 Rat L-FABP ELISA kit KAMIYA 96 well plate 648 €

GEN4293642784 Rat Clusterin ELISA kit KAMIYA 96 well plate 548 €

GEN6007253886 Rat Myoglobin ELISA kit KAMIYA 96 well plate 498 €

GEN2537759992 Rat IgM ELISA kit KAMIYA 96 well plate 389 €

GEN6967073724 Rat IgG ELISA kit KAMIYA 96 well plate 389 €

GEN3067344489 Rat IgE ELISA kit KAMIYA 96 well plate 498 €

GEN6780186493 Rat IgA ELISA kit KAMIYA 96 well plate 389 €

GEN3855112943 Rat Fibrinogen ELISA kit KAMIYA 96 well plate 448 €

GEN6247200027 Rat Ferritin ELISA kit KAMIYA 96 well plate 498 €

GEN4931647984 Rat AT-III ELISA kit KAMIYA 96 well plate 548 €

GEN6880829458 GLP-1 EIA, Human, Mouse, Rat KAMIYA 96 test 1131 €

GEN9586438245 Corticotropin-Releasing Factor ELISA kit, Mouse & Rat KAMIYA 96 test 1238 €

GEN1455655730 Glucagon EIA, Mouse, Rat and Human KAMIYA 96 test 1238 €

GEN4616989719 Leptin (high-sensitive) ELISA kit, Rat KAMIYA 1 kit 1024 €

GEN8269653919 Urocortin 3 EIA, Mouse and Rat KAMIYA 96 test 1131 €

GEN3789388734 GLP-2 EIA, Rat KAMIYA 96 test 1131 €

GEN5043831245 Glicentin EIA, Rat KAMIYA 96 test 1131 €

GEN8272904088 NO Synthase I EIA, Human and Rat KAMIYA 96 test 1131 €

GEN5980643765 Peptide YY (PYY) EIA, Rat KAMIYA 96 test 1131 €

GEN1124216940 C-Peptide EIA, Rat KAMIYA 96 test 1131 €

GEN7263616219 Ghrelin ELISA kit, Desacyl, human, mouse and rat KAMIYA 96 test 978 €

GEN1824527664 Ghrelin ELISA kit, Active, human, mouse and rat KAMIYA 96 test 978 €

GEN4471659420 Osteoclast (Rat) Culture Kit KAMIYA 1 kit 1233 €

GEN7168376686 Rat Thiostatin ELISA kit KAMIYA 1 kit 498 €

GEN8932116435 Rat Serum Amyloid P ELISA kit KAMIYA 1 kit 498 €

GEN1365315296 Rat Transferrin ELISA kit KAMIYA 1 kit 371 €

GEN3031286950 Rat Complement C3 ELISA kit KAMIYA 1 kit 453 €

GEN2524958862 Rat Albumin ELISA kit KAMIYA 1 kit 371 €

GEN3190992677 Rat Alpha-2 Macroglobulin ELISA kit KAMIYA 1 kit 498 €

GEN9825342372 Rat Copeptin (CPP) ELISA kit KAMIYA 96 well plate 1193 €

GEN5222514469 Rat Apolipoprotein C3 (APOC3) ELISA kit KAMIYA 96 well plate 1193 €

GEN1484339788 Rat Lipase, Pancreatic (PL) ELISA kit KAMIYA 96 well plate 1193 €

GEN3843876450 Rat Pentraxin 3, Long (PTX3) ELISA kit KAMIYA 96 well plate 1193 €

GEN9480707844 Rat Aromatase (ARO) ELISA kit KAMIYA 96 well plate 1193 €

GEN4500102608 Rat Prolactin (PRL) ELISA kit KAMIYA 96 well plate 1138 €

GEN6955407314 Rat Uncoupling Protein 1, Mitochondrial (UCP1) ELISA kit KAMIYA 96 well plate 1193 €

GEN8972202881 Rat BCL/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3) ELISA kit KAMIYA 96 well plate 1193 €

GEN4893446976 Rat COL9a1 ELISA kit KAMIYA 96 well plate 1193 €

GEN2314469852 Rat a1AT ELISA kit KAMIYA 96 well plate 1193 €

GEN4734777248 Rat Elastase 2, Neutrophil (ELA2) ELISA kit KAMIYA 96 well plate 1193 €

GEN9598047240 Rat Collagen Type IV (COL4) ELISA kit KAMIYA 96 well plate 1193 €

GEN7396228199 Rat Von Willebrand Factor (vWF) ELISA kit KAMIYA 96 well plate 1193 €

GEN5208317704 Rat VCAM1 ELISA kit KAMIYA 96 well plate 1193 €

GEN7607092301 Rat TNFa ELISA kit KAMIYA 96 well plate 1193 €

GEN2768952980 Rat Tryptase (TPS) ELISA kit KAMIYA 96 well plate 1193 €

GEN5230651645 Rat Trypsinogen Activation Peptide (TAP) ELISA kit KAMIYA 96 well plate 1193 €

GEN9841845379 Rat Trefoil Factor 3, Intestinal (TFF3) ELISA kit KAMIYA 96 well plate 1193 €

GEN1735759895 Human Transglutaminase 1, Keratinocyte (TGM1) ELISA kit KAMIYA 96 well plate 1113 €

GEN4095792963 Rat TGFb1 ELISA kit KAMIYA 96 well plate 1193 €

GEN5016327585 Rat TIMP1 ELISA kit KAMIYA 96 well plate 1193 €

GEN7614221196 Rat Tissue Factor (TF) ELISA kit KAMIYA 96 well plate 1193 €

GEN8219841104 Rat Thyroid Stimulating Hormone (TSH) ELISA kit KAMIYA 96 well plate 1193 €

GEN4903684982 Rat TM ELISA kit KAMIYA 96 well plate 1193 €

GEN1658222054 Rat Beta Thromboglobulin ELISA kit KAMIYA 96 well plate 1193 €

GEN7546976170 Rat Terminal Complement Complex C5b-9 (C5b-9) ELISA kit KAMIYA 96 well plate 1193 €

GEN7253040649 Rat SDH ELISA kit KAMIYA 96 well plate 1193 €

GEN7672201264 Rat Selectin, Platelet ELISA kit KAMIYA 96 well plate 1193 €

GEN6480850887 Rat S100B ELISA kit KAMIYA 96 well plate 1193 €

GEN3867267970 Rat Renin (REN) ELISA kit KAMIYA 96 well plate 1193 €

GEN9580746184 Rat Receptor Activator Of Nuclear Factor Kappa B Ligand (RANkL) ELISA kit KAMIYA 96 well plate 1193 €

GEN7209189155 Rat PRO-C ELISA kit KAMIYA 96 well plate 1193 €

GEN3248610232 Human Proliferating Cell Nuclear Antigen (PCNA) ELISA kit KAMIYA 96 well plate 1113 €

GEN3697196762 Rat Progesterone (Pg) ELISA kit KAMIYA 96 well plate 1193 €

GEN2937758512 Rat Procollagen I N-Terminal Propeptide (PINP) ELISA kit KAMIYA 96 well plate 1193 €

GEN4027716952 Rat Oxidized Low Density Lipoprotein (OxLDL) ELISA kit KAMIYA 96 well plate 1193 €

GEN2202880470 Rat Osteocalcin (OC) ELISA kit KAMIYA 96 well plate 1193 €

GEN7346840432 Rat N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA kit KAMIYA 96 well plate 1193 €

GEN9296592143 Rat Myostatin (MSTN) ELISA kit KAMIYA 96 well plate 1193 €

GEN3540532296 Rat Matrix Metalloproteinase 7 (MMP7) ELISA kit KAMIYA 96 well plate 1193 €

GEN8378494395 Rat MMP3 ELISA kit KAMIYA 96 well plate 1193 €

GEN2926040643 Mouse Macrophage Migration Inhibitory Factor (MIF) ELISA kit KAMIYA 96 well plate 1138 €

GEN1213601712 Rat Luteinizing Hormone ELISA kit KAMIYA 96 well plate 1193 €

GEN5964581217 Rat LDL ELISA kit KAMIYA 96 well plate 1193 €

GEN8303792052 Rat IL6 ELISA kit KAMIYA 96 well plate 1193 €

GEN6758721433 Rat Interleukin 5 (IL5) ELISA kit KAMIYA 96 well plate 1193 €

GEN1906098858 Rat IL4 ELISA kit KAMIYA 96 well plate 1193 €

GEN4384777270 Alpha-1 Acid Glycoprotein, Rat KAMIYA 96 well plate 498 €

GEN2968327592 Rat IL2 ELISA kit KAMIYA 96 well plate 1193 €

GEN3889859556 Rat IL19 ELISA kit KAMIYA 96 well plate 1193 €

GEN2474259251 Haptoglobin ELISA kit, Rat KAMIYA 96 well plate 498 €

GEN4195171119 Rat IL10 ELISA kit KAMIYA 96 well plate 1193 €

GEN6443188889 Rat IL1b ELISA kit KAMIYA 96 well plate 1193 €

GEN3271202332 Rat IFNa ELISA kit KAMIYA 96 well plate 1193 €

GEN7936012009 Rat Inhibin B (INH-B) ELISA kit KAMIYA 96 well plate 1193 €

GEN2092403245 Rat Inhibin A (INH-A) ELISA kit KAMIYA 96 well plate 1193 €

GEN4624109478 Rat HIF1a ELISA kit KAMIYA 96 well plate 1193 €

GEN6113779703 Rat Granzyme B ELISA kit KAMIYA 96 well plate 1193 €

GEN4073296319 Rat GnRH ELISA kit KAMIYA 96 well plate 1193 €

GEN9850502550 Rat Gastrin (GT) ELISA kit KAMIYA 96 well plate 1193 €

GEN1922052153 Rat Follicle Stimulating Hormone (FSH) ELISA kit KAMIYA 96 well plate 1193 €

GEN2011150272 Rat Fibroblast Growth Factor 23 (FGF23) ELISA kit KAMIYA 96 well plate 1193 €

GEN6619542176 Rat Estradiol (E2) ELISA kit KAMIYA 96 well plate 1193 €

GEN8845004073 Rat Erythropoietin (EPO) ELISA kit KAMIYA 96 well plate 1193 €

GEN5301008268 Rat EDN1 ELISA kit KAMIYA 96 well plate 1193 €

GEN5590118231 Rat D-Dimer (D2D) ELISA kit KAMIYA 96 well plate 1136 €

GEN8428501308 Rat CK-M ELISA kit KAMIYA 96 well plate 1193 €

GEN4076219912 Rat Creatine Kinase MB Isoenzyme (CKMB) ELISA kit KAMIYA 96 well plate 1193 €

GEN2864726877 Rat Complement Component 3a (C3a) ELISA kit KAMIYA 96 well plate 1193 €

GEN4605191276 Rat Complement Component 5a (C5a) ELISA kit KAMIYA 96 well plate 1193 €

GEN4160029629 Rat GM-CSF ELISA kit KAMIYA 96 well plate 1193 €

GEN6999935992 GLP-1 , Inactive form (Human, Mouse, Rat) ELISA kit KAMIYA 96 well plate 973 €

GEN9044534573 LRG (Rat) ELISA kit KAMIYA 96 well plate 1081 €

GEN5196418254 Mesothelin N-ERC (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN6419091799 Intact Angiotensinogen (Rat) ELISA kit KAMIYA 96 well plate 952 €

GEN2352626762 Amyloid ß (1-42) mouse, Rat ELISA kit KAMIYA 96 well plate 813 €

GEN6392481353 Amyloid Beta (1-40) (Mouse/Rat) ELISA kit KAMIYA 96 well plate 652 €

GEN5526241562 sAPP? (Mouse/Rat) (highly sensitive) ELISA kit KAMIYA 96 well plate 813 €

GEN6191708022 Angiotensinogen Total (Rat) ELISA kit KAMIYA 96 well plate 891 €

GEN5431270273 Alpha2,6-Sialyltransferase (E41 Form) (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN9238809892 DMP1 (Rat) ELISA kit KAMIYA 96 well plate 968 €

GEN7394501148 Osteopontin (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN4054343206 Leptin (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN9790367685 GIP (Total) (Rat) ELISA kit KAMIYA 96 well plate 913 €

GEN9057084848 GIP (Rat) ELISA kit KAMIYA 96 well plate 968 €

GEN5780242938 TNF- Alpha (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN3096495046 IL-1 Beta (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN8789271792 COX-2 (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN2545419141 Endothelin-1 (Big) (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN5825856623 GRO/CINC-3 (MIP-2) (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN6839319475 GRO/CINC-1 (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN5722406807 Rat Choline Acetyltransferase (ChAT) ELISA kit KAMIYA 96 well plate 1193 €

GEN5919124207 VEGF (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN9603882897 MCP-1 (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN3778246883 GRO/CINC-2 Alpha (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN5707244015 GRO/CINC-2 Beta (Rat) ELISA kit KAMIYA 96 well plate 791 €

GEN4961314577 Mouse and rat LBP ELISA kit KAMIYA 96 well plate 663 €

GEN5371228109 Rat Reference Serum 1 KAMIYA 1 mL 253 €

GEN2543722712 Rat CRP ELISA kit Kit KAMIYA 96 well plate 543 €

GEN2360162497 BrdU Cell Proliferation ELISA kit KAMIYA 200 well plate 403 €

GEN6350620028 Rabbit Anti-Rat Kilham Virus (KRV) capsid protein VP2 antiserum ADI 100 μL 536 €

GEN6964908224 Rat Anti-Rat Kilham Virus (KRV) capsid protein VP2 antibody positive control serum ADI 1 mL 260 €

GEN4205286066 Rat Anti-Rat Kilham Virus (KRV) capsid protein VP2 antibody negative control serum ADI 1 mL 188 €

GEN5607222594 Recombinant (E. coli) Rat Kilham Virus (KRV) capsid protein VP2 (>95%, his-tag, ~65 Kda) ADI 10 μg 478 €

GEN3223109417 Recombinant purified Rat Kilham Virus (KRV) capsid protein VP2 control for Western blot ADI 100 μL 333 €

GEN7414483664 Clad penetration test solution REAGECO 1L 268 €

GEN6067695968 Alkaline solution Potassium Sodium Tartrate 0,886M REAGECO 1L 130 €

GEN3947943713 Mouse Monoclonal Anti-Human Human Ki67 (Proliferation Marker) peptide IgG ADI 100 μL 565 €

GEN8343248041 Rabbit Anti-Human Human Ki67 (Proliferation Marker) peptide IgG ADI 100 μL 565 €

GEN9292344268 Potassium Hexacyanoferrate II solution 10% W / V REAGECO 1L 132 €

GEN5944260251 Analytical Volumetric concentration Potassium Chloride 0.01M 0.01N REAGECO ampoule 93 €

GEN8539125737 Rabbit Anti-Rat K-Cl Cotransporter 2 (KCC2) ADI 100 μL 536 €

GEN1982466502 Rat K-Cl Cotransporter 2 (KCC2) Control/blocking peptide #1 ADI 100 μg 188 €

GEN8179418873 Rabbit Anti-Rat K-Cl Cotransporter 2 (KCC2) IgG #1, aff pure ADI 100 μg 565 €

GEN4472051740 Rabbit Anti-Rat K-Cl Cotransporter 1 (KCC1) ADI 100 μL 536 €

GEN6607885314 Rat K-Cl Cotransporter 1 (KCC1) Control/blocking peptide #1 ADI 100 μg 188 €

GEN2026632413 Rabbit Anti-Rat K-Cl Cotransporter 1 (KCC1) ADI 100 μg 565 €

GEN8676474892 Alpha-Ketoglutarate Dehydrogenase Activity Colorimetric Assay Kit 100 assays APE 100 assays 948 €

GEN4831395660 Alpha-Ketoglutarate Colorimetric/Fluorometric Assay Kit 100 assays APE 100 assays 506 €

GEN8279520814 Citrate Colorimetric/Fluorometric Assay Kit 100 assays APE 100 assays 506 €

GEN4802905367 Caspase Colorimetric Substrate Set 7 * 25 assays APE 7 * 25 assays 558 €

GEN1522468605 PEG Virus Precipitation Kit 50 preparations APE 50 preparations 376 €

GEN1992715477 PEG Virus Precipitation Kit 200 preparations APE 200 preparations 987 €

GEN5138949087 ECL Western Blotting Substrate Kit 500 assays APE 500 assays 337 €

GEN9898651369 ECL Western Blotting Substrate Kit 50 assays APE 50 assays 147 €

GEN1859988633 Deproteinizing Sample Preparation Kit 200 assays APE 200 assays 298 €

GEN9687607558 Caspase Colorimetric Substrate Set II Plus 9 * 25 assays APE 9 * 25 assays 857 €

GEN8563615850 Caspase Fluorometric Substrate Set II Plus 9 * 25 assays APE 9 * 25 assays 857 €

GEN7154654119 Caspase Colorimetric Substrate Set Plus 7 * 25 assays APE 7 * 25 assays 727 €

GEN2104523213 Caspase Fluorometric Substrate Set Plus 7 * 25 assays APE 7 * 25 assays 727 €

GEN9072950468 Caspase Colorimetric Substrate Set II 9 * 25 assays APE 9 * 25 assays 688 €

GEN4188161090 β-Hydroxybutyrate ( β-HB ) Colorimetric Assay Kit 100 assays APE 100 assays 506 €

GEN2598095259 Cytosol/Particulate Separation Kit 50 assays APE 50 assays 389 €

GEN7329949050 ADP/ATP Ratio Bioluminescence Assay Kit 200 assays APE 200 assays 623 €

GEN1321158931 Citrate Synthase Activity Colorimetric Assay Kit 100 assays APE 100 assays 519 €

GEN2292438934 Ready-to-use Cell Proliferation Reagent, WST-1 2500 assays APE 2500 assays 558 €

GEN9596317946 WST Cell Proliferation Colorimetric Assay Kit plus 500 assays APE 500 assays 298 €

GEN1827634864 WST Cell Proliferation Colorimetric Assay Kit plus 2500 assays APE 2500 assays 558 €

GEN7773326540 WST-1 Cell Proliferation Colorimetric Assay Kit 500 assays APE 500 assays 298 €

GEN7817141237 WST-1 Cell Proliferation Colorimetric Assay Kit 2500 assays APE 2500 assays 558 €

GEN3989087784 SWAN AMI LineTOC Calibration standard 1.0 mg/L C USP Sucrose REAGECO 250ml 257 €

GEN4620347812 SWAN AMI LineTOC USP Calibration Kit; Reagent water, 1.0 mg/L C USP Sucrose REAGECO Kit 257 €

GEN6928708011 Membrapure USP Calibration Kit; Reagent water, 1.0 mg/L C USP Sucrose REAGECO Kit 438 €

GEN3948536504 Calibration Kit;Blank, 0.25 mg/L C NIST Sucrose,0.5 mg/L C NIST Sucrose,0.75 mg/L C NIST Sucrose. REAGECO 4x60ml Kit 283 €

GEN2515128518 Anatel A643 Calibration standard 0.75 mg/L C NIST Sucrose REAGECO 60ml 137 €

GEN3336323907 Anatel A643 Calibration standard 0.5 mg/L C NIST Sucrose REAGECO 60ml 137 €

GEN2005385917 Anatel A643 Calibration standard 0.25 mg/L C NIST Sucrose REAGECO 60ml 137 €

GEN7976015046 Anatel A643 Calibration Blank REAGECO 60ml 137 €

GEN1967911797 Calibration standard 50 mg/L C NIST KHP REAGECO 125ml 195 €

GEN3294406384 Calibration standard 50 mg/L C NIST KHP REAGECO 40ml 137 €

GEN5970349643 Calibration standard 25mg/L NIST KHP REAGECO 125ml 195 €

GEN3209706359 Calibration standard 25mg/L NIST KHP REAGECO 40ml 137 €

GEN1501849326 Calibration standard 10mg/L NIST KHP REAGECO 125ml 174 €

GEN7469423726 Calibration standard 10mg/L NIST KHP REAGECO 40ml 128 €

GEN4334632905 Calibration standard 5mg/L NIST KHP REAGECO 125ml 174 €

GEN8433983190 Calibration standard 5mg/L NIST KHP REAGECO 40ml 128 €

GEN4489043384 Calibration standard 1mg/L NIST KHP REAGECO 125ml 174 €

GEN2376591070 Calibration standard 1mg/L NIST KHP REAGECO 40ml 128 €

GEN8612163719 Calibration standard 0.75 mg/L C NIST KHP REAGECO 40ml 128 €

GEN9215690819 Calibration standard 0.5 mg/L C NIST KHP REAGECO 125ml 174 €

GEN5811446978 Calibration standard 0.5 mg/L C NIST KHP REAGECO 40ml 128 €

GEN2806291765 Calibration standard 0.25 mg/L C NIST KHP REAGECO 40ml 128 €

GEN4069459486 Calibration standard 0.1 mg/L C NIST KHP REAGECO 40ml 133 €

GEN6056941216 Calibration Kit; 2 x calibration blanks, 0.25 mg/L C Sucrose and 0.5mg/L Sucrose. 500ml Bottles REAGECO Kit 1164 €

GEN4496495823 Calibration standard 0.5 mg/L C NIST Sucrose REAGECO 500ml 438 €

GEN2271764479 Calibration standard 0.25 mg/L C NIST Sucrose REAGECO 500ml 438 €

GEN3159376605 Calibration Blank REAGECO 500ml 438 €

GEN2161349279 Calibration standard 0.75 mg/L C NIST Sucrose REAGECO 1L 692 €

GEN4340033830 Calibration Kit;2 x blank,2 x 0.1 mg/L,2 x 0.25 mg/L , 2 x 0.5 mg/L ,0.75 mg/L,1 mg/L C NIST KHP REAGECO 10x40ml Kit 529 €

GEN9912729552 Calibration standard 0.75 mg/L C NIST Sucrose REAGECO 125ml 187 €

GEN3780292456 Calibration standard 0.5 mg/L C NIST Sucrose REAGECO 1L 692 €

GEN6152059487 Calibration standard 0.5 mg/L C NIST Sucrose REAGECO 125ml 187 €

GEN4727553306 Calibration standard 0.25 mg/L C NIST Sucrose REAGECO 1L 692 €

GEN3980753124 Calibration standard 0.25 mg/L C NIST Sucrose REAGECO 125ml 174 €

GEN4361764211 Calibration Blank REAGECO 1L 692 €

GEN4328213076 Calibration Blank REAGECO 125ml 174 €

GEN8329713636 Individual TOC/TIC Calibration Blank REAGECO 125ml 174 €

GEN5389879598 Individual TOC/TIC Calibration Blank REAGECO 40ml 128 €

GEN4744278583 100 μS/cm Conductivity standard for Calibration REAGECO 60ml 107 €

GEN2503096612 100 μS/cm Conductivity standard for Calibration REAGECO 60ml 100 €

GEN9410363671 100 μS/cm Conductivity standard for Calibration REAGECO 125ml 131 €

GEN3202790429 0.75 mg/L C from NIST Sucrose Calibration standard REAGECO 60ml 137 €

GEN5276291266 0.5 mg/L C from NIST Sucrose Calibration standard REAGECO 60ml 137 €

GEN9348457634 0.25 mg/L C NIST Sucrose Calibration standard REAGECO 60ml 137 €

GEN9420299640 Calibration Blank REAGECO 60ml 137 €

GEN9233858118 Calibration standard 1.25 mg/L C NIST Sucrose REAGECO 500ml 438 €

GEN5782407062 Ion Selective Electrode standard Perchlorate 1000 ppm REAGECO 500ml 174 €

GEN1828204038 Ion Selective Electrode standard Nitrate 1000 ppm as NO3 REAGECO 5L 503 €

GEN5750183838 Ion Selective Electrode standard Nitrate 1000 ppm as NO3 REAGECO 500ml 155 €

GEN4184112555 Ion Selective Electrode standard Nitrate 10 ppm as NO3 REAGECO 5L 503 €

GEN7346659798 Ion Selective Electrode standard Nitrate 10 ppm as NO3 REAGECO 500ml 151 €

GEN2796160977 Ion Selective Electrode standard Nitrate 100 ppm as NO3 REAGECO 5L 503 €

GEN1550113200 Ion Selective Electrode standard Nitrate 100 ppm as NO3 REAGECO 500ml 151 €

GEN6692698184 Ionic Strength Adjustor Perchlorate 2M NH42SO4 REAGECO 500ml 178 €

GEN1540685011 Ionic Strength Adjustor Nitrate 2M NH42SO4 REAGECO 500ml 155 €

GEN1868125863 Rabbit Anti-Rat/human Iron regulatory protein 2 (IRP-2) ADI 100 μL 536 €

GEN6510035962 Rat/human Iron regulatory protein 2 (IRP-2) control/blocking peptide ADI 100 μg 188 €

GEN5748969458 Rabbit Anti-Rat/human Iron regulatory protein 2 (IRP-2) IgG, aff pure ADI 100 μg 565 €

GEN6783721042 Rabbit Anti-Rat Iron regulatory protein 1 (IRP-1) antiserum ADI 100 μL 536 €

GEN9761925567 Rat Iron regulatory protein 1 (IRP-1) control/blocking peptide ADI 100 μg 188 €

GEN9091338218 Rabbit Anti-Rat Iron regulatory protein 1 (IRP-1) ADI 100 μg 565 €

GEN8818492201 Rabbit Anti-Rat IRAP (Insulin regulated aminopeptidase) Antiserum #1 ADI 100 μL 536 €

GEN1337945842 Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1 ADI 100 μg 188 €

GEN5039073531 Rabbit Anti-Rat IRAP (Insulin regulated aminopeptidase) IgG #1, aff pure ADI 100 μg 565 €

GEN3882726899 Rabbit Anti-Human (mouse/rat) Insulin antiserum ADI 100 μL 536 €

GEN4141376352 Monoclonal Anti-Rat C-peptide IgG, aff pure ADI 100 μg 565 €

GEN4764923156 Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure ADI 100 μg 565 €

GEN7064167156 Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] ADI 500 μg 405 €

GEN7690167842 Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure ADI 100 μL 565 €

GEN2262969739 Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure ADI 100 μL 565 €

GEN8360369156 Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN] ADI 500 μg 333 €

GEN4028876635 Mouse Monoclonal Anti-Mouse/rat NOS-II/i-NOS peptide ADI 100 μL 565 €

GEN2495206353 Luciferin-Luciferase Concentrate - 1 ml VIRUSYS 1 item 195 €

GEN8360810205 anti-Isocitrate dehydrogenase Antibody FITC FABGEN 100 µg 456 €

GEN9142859450 anti-Isocitrate dehydrogenase Antibody BIOTIN FABGEN 100 µg 456 €

GEN2852296273 anti-Isocitrate dehydrogenase Antibody FABGEN 100 µg 357 €

GEN5477421806 ICP Multi-element standard, in 2.5% of Glucose Monohydrate Na at 25 ppm, K at 100 ppm, Mg at 5 ppm, Ca at 50 ppm REAGECO 100ml 232 €

GEN6500832457 Ion chromatography Multi-element 7 Anion standard Bromide, Chloride, Fluoride, Nitrite, Nitrate, Phosphate, Sulfate at 1000 ppm each REAGECO 100ml 193 €

GEN5142569657 Proliferating Cell Nuclear Antigen (PCNA), Cyclin, Clone: PC10, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 553 €

GEN9360495254 Cytokeratin 8 (expressed in combo. w/7,18,19), Clone: M20, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN9617444125 Cytokeratin 20, 46kD, Clone: Ks 20.8, Mouse Monoclonal antibody-Human; frozen/cell preps/paraffin, IH ACCURATE MONOCLONALS 1000ul 528 €

GEN4460345787 Cytokeratin 18, 45kD, Clone: DA-7, Mouse Monoclonal antibody-Human, frozen/paraffin (microwave) ACCURATE MONOCLONALS 1000ul 465 €

GEN4225531224 Cytokeratin 7 & 17, 54kD & 46kD, Clone: C-46, Mouse Monoclonal antibody-Human, frozen/paraffin (microwave) ACCURATE MONOCLONALS 1000ul 465 €

GEN5234332990 Cytokeratin 4, non-cornifying squamous epithelia, ciliated pseudostratified epithelium, Clone: 6B10, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN2436130068 Cytokeratin 10, keratinizing squamous epithelia, Clone: RKSE60, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN7911822683 Cytokeratin 8, 18, simple Epithelia, Clone: NCL-5D3, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 475 €

GEN3956706268 Cytokeratin 18, Glandular Epithelial cells, Clone: RGE53, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN2455861280 Cytokeratin 13, non-cornifying squamous epithelia & transitional epithelium (bladder), Clone: 2D7, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN4030369147 Cytokeratin 13, non-cornifying squamous epithelia & transitional epithelium (bladder), Clone: 1C7, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN5622995586 Cytokeratin 7, 54kD, Clone: OVTL 12-30, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN3224759718 Cytokeratin 19, most simple & non-keratinized Stratified Epithelia, Clone: RCK 108, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN2923782866 Cytokeratin, Clone: RCK 107, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN9854312717 Cytokeratin 18, all Adenoepithelia, Clone: RCK 106, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN4415009583 Cytokeratin 7, Columnar & Glandular epith. of lung,cervix,breast,bile ducts(no GI), Clone: RCK105, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN9031353225 Cytokeratin, Clone: 103, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN8364514517 Cytokeratin 5 + 8, all Epithelial Cell types and tumors, Clone: RCK102, Mouse Monoclonal antibody- ACCURATE MONOCLONALS 1000ul 465 €

GEN8808626418 La (SS-B) antigen, Clone: La4B6, Mouse Monoclonal antibody-Human, Mouse, Rat, Bovine; IF/IB ACCURATE MONOCLONALS 1000ul 0 €

GEN2228852032 Single element Ion Chromatography standard 100 ppm Perchlorate in water - s/l: 6mth REAGECO 100ml 114 €

GEN5324945796 Ion chromatography Anion standard Tartrate 100 ppm in pure water REAGECO 100ml 128 €

GEN7519242257 Ion chromatography Anion standard Nitrate 100 ppm in pure water REAGECO 100ml 99 €

GEN2403414447 Ion chromatography Anion standard Tartrate 200 ppm in pure water REAGECO 100ml 128 €

GEN2820573644 Ion chromatography Anion standard Nitrate 200 ppm in pure water REAGECO 100ml 100 €

GEN1188575231 Ion Chromatography Multi Element 5 Anion standard Fluoride at 100 ppm, chloride at 100 ppm, Nitrate at 200 ppm, Phosphate at 200 ppm, and Sulphate at 200 ppm REAGECO 100ml 253 €

GEN1335838666 Ion Chromatography Anion standard Citrate 1mg/ml 1000 ppm 100ml REAGECO 100ml 141 €

GEN1592930972 Ion Chromatography Perchlorate standard 1000 ppm Perchlorate in water REAGECO 100ml 117 €

GEN8032593227 Ion chromatography Anion standard Tartrate 1000 ppm in pure water REAGECO 100ml 138 €

GEN6733455383 Ion chromatography Anion standard Nitrate 1000 ppm in pure water REAGECO 250ml 128 €

GEN1215665808 Ion chromatography Anion standard Nitrate 10000 ppm in pure water REAGECO 500ml 305 €

GEN8259215970 Ion chromatography Anion standard Nitrate 1000 ppm in pure water REAGECO 100ml 100 €

GEN2818355461 Ion chromatography Anion standard Chlorate 1000 ppm in pure water REAGECO 50ml 133 €

GEN7768035743 Ion chromatography Anion standard Chlorate 1000 ppm in pure water REAGECO 100ml 135 €

GEN6383112502 Ion chromatography Anion standard Tartrate 1000 ppm in pure water REAGECO 500ml 237 €

GEN4543404921 Ion chromatography Anion standard Nitrate 1000 ppm in pure water REAGECO 500ml 138 €

GEN8938284913 Ion Chromatography Multi element 7 Anion standard Fluoride 2 ppm, Chloride 300 ppm, Nitrite 10 ppm, Bromide 5 ppm, Nitrate 100 ppm, Phosphate 100 ppm, Sulphate 400 ppm in Water REAGECO 500ml 364 €

GEN8768271460 Ion chromatography Multi-Element standard, 7 Elements mixed concentrations in pure water REAGECO 500ml 352 €

GEN3218813293 Ion chromatography Multi-Element standard, 7 Elements mixed concentrations in pure water REAGECO 1L 670 €

GEN3152640562 Ion Chromatography Multi element 6 Anion standard Chloride,Phosphate,Nitrate,Sulphate 1g/l each,Fluoride,bromide,100mg/l each REAGECO 250ml 332 €

GEN2065383031 Ion Chromatography Multi element 6 Anion standard, Matrix pure water, Fluoride , Chloride, Bromide, Nitrate, Phosphate, Sulphate at 10 ppm each REAGECO 100ml 271 €

GEN4032248514 Ion chromatography Multi-Element standard, 5 Anions mixed concentrations in pure water REAGECO 500ml 352 €

GEN6169431807 Ion chromatography Multi-Element standard, 5 Anions mixed concentrations in pure water REAGECO 500ml 352 €

GEN2071866408 Ion chromatography Multi-Element standard, 4 Elements mixed concentrations in pure water REAGECO 500ml 211 €

GEN6512543177 Ion chromatography Multi-Element standard, 7 Anions mixed concentrations in pure water REAGECO 100ml 335 €

GEN7389384876 Ion chromatography Multi-Element standard, 7 Anions mixed concentrations in pure water REAGECO 500ml 378 €

GEN3784708520 Ion chromatography Multi-Element standard, 6 Anions mixed concentrations in pure water REAGECO 500ml 256 €

GEN5235099567 Ion Chromatography Multi element 5 Anion standard in water, chloride, Phosphate, Nitrate, nitrite, sulphates, 1g/l each REAGECO 100ml 292 €

GEN6932021301 Ion Chromatography Multi Element 3 Anion standard Chloride,Nitrate and Sulphate at 1000 ppm each REAGECO 500ml 426 €

GEN7217671017 Ion chromatography Multi-element 6 Anion standard Nitrite, Nitrate, Chloride, Sulfate, Fluoride, Phosphate at 100 ppm each in pure water REAGECO 100ml 256 €

GEN8568767080 Analytical Volumetric concentration Iodine 0.025M 0.05N REAGECO ampoule 123 €

GEN6884485146 Analytical Volumetric concentration Iodine 0.05M 0.1N REAGECO ampoule 124 €

GEN2871913665 Analytical Volumetric concentration Iodine 0.005M 0.01N REAGECO ampoule 118 €

GEN8919316537 Ion chromatography Multi-element 7 Anion standard Fluoride 20 ppm, Chloride 100 ppm, Nitrite 100 ppm, Bromide 100 ppm, Nitrate 100 ppm, Phosphate 200 ppm & Sulphate 100 ppm REAGECO 100ml 256 €

GEN8142622005 Ion chromatography Multi-Element standard, 4 Elements mixed concentrations in pure water REAGECO 500ml 363 €

GEN3319916467 Ion chromatography Multi-Element standard, 3 Elements mixed concentrations in pure water, tr. HNO3 REAGECO 100ml 153 €

GEN4860044825 Ion chromatography Multi-Element standard, 7 Elements mixed concentrations in pure water REAGECO 500ml 298 €

GEN5345747501 Ion chromatography Multi-element 6 Anion standard Bromide, Nitrate, Chloride, Phosphate, Fluoride, Sulphate, 1000 mg/L each , Matrix: water REAGECO 500ml 434 €

GEN2322885612 Ion chromatography Multi-Element standard, 2 Elements mixed concentrations in 1% HNO3 REAGECO 100ml 276 €

GEN6933994401 Ion chromatography Multi-Element standard, 4 Elements mixed concentrations in pure water REAGECO 500ml 286 €

GEN7775629955 Ion chromatography Multi-Element standard, 6 Elements mixed concentrations in pure water REAGECO 500ml 286 €

GEN9422847211 Ion chromatography Multi-Element standard, 4 Elements mixed concentrations in pure water REAGECO 500ml 286 €

GEN6021448431 Influenza B Antigen Calibration Kit VIRUSYS 1 item 359 €

GEN1451791827 Influenza A Antigen Calibration Kit VIRUSYS 1 item 359 €

GEN1459350188 IAV Sample Preparation Reagent - 60 ml VIRUSYS 1 item 125 €

GEN6137393921 Conglutinin, CRD Domain (carbohydrate recognition domain), alpha helical neck region, C-terminal, NO X w/CL-43, Clone: 263-02, Mouse Monoclonal antibody-Bovine; ELISA/No WB ACCURATE MONOCLONALS 0.2mg 1234 €

GEN8792119448 Conglutinin, CRD Domain (carbohydrate recognition domain), alpha helical neck region, C-terminal, NO X w/CL-43, Clone: 263-01, Mouse Monoclonal antibody-Bovine; ELISA/WB ACCURATE MONOCLONALS 0.2mg 1234 €

GEN1205048842 Glycoprotein 340, Carbohydrate epitope, MUC7 (saliva), Clone: 213-06, Mouse Monoclonal antibody-Human; ELISA/WB/IH ACCURATE MONOCLONALS 0.2mg 1234 €

GEN9246863591 Glycoprotein 340, Carbohydrate epitope, MUC7 (saliva), Clone: 213-01, Mouse Monoclonal antibody-Human; ELISA/WB/IH ACCURATE MONOCLONALS 0.2mg 1234 €

GEN5377639854 Acetylcholinesterase (AChE), C-terminal 10 residues of brain (G4), aa 574-583, native & denatured, NO X w/rbc (G2), No X w/BtChE, Clone: 190-02, Mouse Monoclonal antibody-Human, Bovine, weak X w/Torpedo marmorata, NO X w/Electric eel; ELISA/Blotting ACCURATE MONOCLONALS 0.2mg 0 €

GEN5873510945 Acetylcholinesterase (AChE), C-terminal 10 residues of brain (G4), native & denatured, NO X w/rbc (G2), No X w/BtChE, Clone: 190-01, Mouse Monoclonal antibody-Human, Bovine, weak X w/Torpedo marmorata, NO X w/Electric eel; ELISA/Blotting ACCURATE MONOCLONALS 0.2mg 1234 €

GEN4521341349 Mannan-Binding Lectin (MBL), Clone: 131-18, Mouse Monoclonal antibody-Human,Rat; ELISA ACCURATE MONOCLONALS 0.2mg 1234 €

GEN5428859798 Rat C3 Complement, Clone: 118-03, Mouse Monoclonal antibody-, NO X w/Human; ELISA/IH ACCURATE MONOCLONALS 0.2mg 0 €

GEN8387682265 Rat C3 Complement, Clone: 118-02, Mouse Monoclonal antibody-, NO X w/Human; ELISA/IH ACCURATE MONOCLONALS 0.2mg 1234 €

GEN8564789426 Rat C3 Complement, Clone: 118-01, Mouse Monoclonal antibody-, NO X w/Human; ELISA/IH ACCURATE MONOCLONALS 0.2mg 0 €

GEN7868973888 Acetylcholinesterase (AChE), native detergent soluble, brain (G4) or rbc (G2), No X w/BtChE, Clone: 111-05, Mouse Monoclonal antibody-Human, NO X w/Torpedo marmorata or Flounder; ELISA/Blotting ACCURATE MONOCLONALS 0.2mg 1234 €

GEN2690334353 Acetylcholinesterase (AChE), body muscle, Clone Cocktail, Mouse Monoclonal antibody-Flounder, NO X w/Torpedo marmorata, Human, Bovine; ELISA ACCURATE MONOCLONALS 0.2mg 0 €

GEN5630335996 Acetylcholinesterase (AChE), N-linked carbohydrate epitopes, Clone Cocktail, Mouse Monoclonal antibody-Torpedo marmorata, Human & Bovine brain, Flounder; ELISA/Blotting ACCURATE MONOCLONALS 0.2mg 0 €

GEN7032377236 Acetylcholinesterase (AChE), native, heat denatured (weakly), brain (G4) or rbc (G2), No X w/BtChE, Clone: 101-03, Mouse Monoclonal antibody-Human, Bovine, Electric Eel, NO X w/Torpedo marmorata or Flounder; ELISA ACCURATE MONOCLONALS 0.2mg 0 €

GEN8172217255 Acetylcholinesterase (AChE), native, brain (G4) or rbc (G2), No X w/BtChE, Clone: 101-04, Mouse Monoclonal antibody-Human, Bovine, NO X w/Torpedo marmorata or Flounder; ELISA ACCURATE MONOCLONALS 0.2mg 0 €

GEN8757931285 Acetylcholinesterase (AChE), native, heat denatured, SDS plus heat denatured, brain (G4) or rbc (G2), No X w/BtChE, Clone: 101-03, Mouse Monoclonal antibody-Human, Bovine, NO X w/Torpedo marmorata or Flounder; ELISA/Blotting ACCURATE MONOCLONALS 0.2mg 1234 €

GEN6150608369 Acetylcholinesterase (AChE), native, brain (G4) or rbc (G2), No X w/BtChE, Clone: 101-02, Mouse Monoclonal antibody-Human, Bovine, NO X w/Torpedo marmorata or Flounder; ELISA ACCURATE MONOCLONALS 0.2mg 0 €

GEN3580849385 Acetylcholinesterase (AChE), native, brain (G4) or rbc (G2), No X w/BtChE, Clone: 101-01, Mouse Monoclonal antibody-Human, Bovine, NO X w/Torpedo marmorata; ELISA ACCURATE MONOCLONALS 0.2mg 0 €

GEN5676634196 Mycobacterium tuberculosis ESAT-6, PPD, 10kD, Clone Cocktail, Mouse Monoclonal antibody-PPD, culture filtrate, cytosol, cell wall preps; ELISA/WB ACCURATE MONOCLONALS 0.2mg 1623 €

GEN1919225526 Hirudin, N-terminal, Clone: 010-07, Mouse Monoclonal antibody-Rabbit, Rat, Dog, Monkey; ELISA/No WB ACCURATE MONOCLONALS 0.2mg 0 €

GEN5320601138 Hirudin, N-terminal, Clone: 010-06, Mouse Monoclonal antibody-Rabbit, Rat, Dog, Monkey; ELISA/No WB ACCURATE MONOCLONALS 0.2mg 1234 €

GEN9938743090 Hirudin, C-terminal, Clone: 010-02, Mouse Monoclonal antibody-Rabbit, Rat, Dog, Monkey; ELISA/WB ACCURATE MONOCLONALS 0.2mg 1234 €

GEN9808164909 Human/rat HSP90 (K69) non-acetylated peptide # 2 ADI 100 μg 188 €

GEN4424450702 Human/rat HSP90 (acK69) acetylated peptide # 1 ADI 100 μg 188 €

GEN1193578465 Rabbit Anti-Human/rat HSP90 (acK69) ADI 100 μL 565 €

GEN5840266050 Human/rat HSP90 (K558) non-acetylated peptide # 1 ADI 100 μg 188 €

GEN9843202966 Human/rat HSP90 (acK558) acetylated peptide # 1 ADI 100 μg 188 €

GEN5165171624 Rabbit Anti-Human/rat HSP90 (acK558) IgG #1, aff pure ADI 100 μg 565 €

GEN4526529921 Human/rat HSP90 (K294) non-acetylated peptide # 2 ADI 100 μg 188 €