Total products: 29633
peptide
Filters
SKU Product name Supplier Size Price
GEN2967176063 Human novel liver specific OAT (LST-1) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN3999541760 DELFNELLNSVDVNGENILEESQ, P. falciparum Liver-Stage Antigen 3-NRI (LSA3-NRI) peptide Info ADI 1 mg 260 €
GEN9181365121 LEESQVNDDIFNSLVKSVQQEQQHNV, P. falciparum Liver-Stage Antigen 3-NRII, LSA3-NRII (81-106) peptide Info ADI 1 mg 333 €
GEN5700743099 Mouse Lipin-3 Control/blocking peptide control/blocking peptide #1 Info ADI 100 μg 188 €
GEN6785099077 Mouse Lipin-2 Control/blocking peptide control/blocking peptide #1 Info ADI 100 μg 188 €
GEN9590211461 Mouse Lipin-1 Control/blocking peptide control/blocking peptide #1 Info ADI 100 μg 188 €
GEN2046676807 Human Livin Control/blocking peptide Info ADI 100 μg 188 €
GEN2360866794 Human Leuteinizing Hormone releasing hormone (LHRH) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN2155174747 Lethal factor Protease Substrate 3, AMC derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) Info ADI 1 mg 478 €
GEN8711570930 Lethal factor Protease Substrate 2, pNA derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) Info ADI 1 mg 478 €
GEN2594211882 Lethal factor Protease Substrate 1, Internally quenched Coumarin peptide substrate for monitoring LF protease activity (19aa) Info ADI 500 μg 623 €
GEN5881871520 Rabbit Anti-B. Anthracis Lethal factor (LF) (C-terminal peptide) IgG#3 Info ADI 100 μg 565 €
GEN8591771157 Human Liver-expressed antimicrobial peptide 2 (LEAP2) Control/blocking peptide Info ADI 100 μg 188 €
GEN5816298942 Rabbit Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) Info ADI 100 μg 565 €
GEN5104198466 Human Liver-expressed antimicrobial peptide 2 (LEAP2) Control/blocking peptide Info ADI 100 μg 188 €
GEN9366467172 Rabbit Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) Info ADI 100 μg 565 €
GEN6214326778 Rat Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1193 €
GEN7445975678 Pig Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1278 €
GEN8741953303 Mouse Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5557267339 Human Atrial Natriuretic Peptide ELISA kit Info KAMIYA 96 well plate 1113 €
GEN7586268684 Rabbit Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN3652226731 Mouse C Telopeptide of Type I Collagen (CTX1) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN4293272777 Human C telopeptide of type I collagen (CTX-1) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN3878337358 Rat Vasoactive Intestinal Peptide (VIP) ELISA kit Info KAMIYA 96 well plate 1091 €
GEN8071733741 Rat Procollagen III N Terminal Propeptide (PIIINP) ELISA kit Info KAMIYA 96 well plate 1091 €
GEN7944377179 Mouse Peptide Yy (PYY) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2135288322 Rabbit Cross Linked N-Telopeptide of Type I Collagen ELISA kit Info KAMIYA 96 well plate 1091 €
GEN4896506454 Human N-Terminal pro-Brain Natriuretic Peptide (NT-proBNP) ELISA kit Info KAMIYA 96 well plate 1106 €
GEN4978570586 Mouse Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN3304112749 Rabbit Atrial Natriuretic Peptide ELISA kit Info KAMIYA 96 well plate 1091 €
GEN7821308288 Human Insulin Like Peptide 5 (INSL5) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN5584133382 Human C Terminal Procollagen III Peptide (PIIICP) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN4850968117 Peptide YY (PYY) EIA, Human Info KAMIYA 96 test 1131 €
GEN5980643765 Peptide YY (PYY) EIA, Rat Info KAMIYA 96 test 1131 €
GEN6453462312 C-Peptide EIA, Mouse Info KAMIYA 96 test 1238 €
GEN9122130403 C-Peptide II EIA,Mouse Info KAMIYA 96 test 1238 €
GEN3508325370 C-Peptide I EIA, Mouse Info KAMIYA 96 test 1238 €
GEN1124216940 C-Peptide EIA, Rat Info KAMIYA 96 test 1131 €
GEN9334534541 Human Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN3739558427 Pig N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA kit Info KAMIYA 96 well plate 1278 €
GEN7128784882 Bovine Procollagen II N-Terminal Propeptide (PIINP) ELISA kit Info KAMIYA 96 well plate 1278 €
GEN5230651645 Rat Trypsinogen Activation Peptide (TAP) ELISA kit Info KAMIYA 96 well plate 1193 €
GEN2937758512 Rat Procollagen I N-Terminal Propeptide (PINP) ELISA kit Info KAMIYA 96 well plate 1193 €
GEN8368642975 Human Procollagen I N-Terminal Propeptide (PINP) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN4804427094 Human Procollagen I C-Terminal Propeptide (PICP) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN9957410760 Human Pro-Gastrin Releasing Peptide (ProGRP) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN9187331414 Human N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN7346840432 Rat N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA kit Info KAMIYA 96 well plate 1193 €
GEN6248802302 Mouse N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2310645440 Dog N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA kit Info KAMIYA 96 well plate 1233 €
GEN8007015604 Human Neuropeptide Y (NPY) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN5099397508 Human Fibrinopeptide B (FPB) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN9641587542 Mouse Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2020799177 Human Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA kit Info KAMIYA 96 well plate 1113 €
GEN5012472451 Mouse Cross Linked C-Telopeptide Of Type I Collagen (CTXI) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9381580854 Human KST1 Control/blocking peptide # 1 Info ADI 100 μg 188 €
GEN3602280503 Mouse Klotho Control/blocking peptide Info ADI 100 μg 188 €
GEN3947943713 Mouse Monoclonal Anti-Human Human Ki67 (Proliferation Marker) peptide IgG Info ADI 100 μL 565 €
GEN8343248041 Rabbit Anti-Human Human Ki67 (Proliferation Marker) peptide IgG Info ADI 100 μL 565 €
GEN5588673121 Human K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #2 Info ADI 100 μg 188 €
GEN3273112351 Mouse K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN5934005694 Human/Mouse K-Cl Cotransporter 3 (KCC3-a) Control/blocking peptide #2 Info ADI 100 μg 188 €
GEN4993061586 Human K-Cl Cotransporter 3 (KCC3) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN1982466502 Rat K-Cl Cotransporter 2 (KCC2) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN6607885314 Rat K-Cl Cotransporter 1 (KCC1) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN6510035962 Rat/human Iron regulatory protein 2 (IRP-2) control/blocking peptide Info ADI 100 μg 188 €
GEN9761925567 Rat Iron regulatory protein 1 (IRP-1) control/blocking peptide Info ADI 100 μg 188 €
GEN1337945842 Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN8041916707 Human glutamate/GABA Inhibitory protein factor (IPF) control/blocking peptide Info ADI 100 μg 188 €
GEN4519747351 Human ice Protease-Activating Factor (IPAF) or CARD12 Control/blocking peptide Info ADI 100 μg 188 €
GEN4141376352 Monoclonal Anti-Rat C-peptide IgG, aff pure Info ADI 100 μg 565 €
GEN8659230528 Monoclonal Anti-Human Insulin C-terminal pentapeptide IgG, aff pure Info ADI 100 μg 565 €
GEN7350208029 Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] Info ADI 500 μg 405 €
GEN3026001775 Monoclonal Anti-Human Insulin C-peptide IgG, aff pure Info ADI 100 μL 565 €
GEN7064167156 Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] Info ADI 500 μg 405 €
GEN7690167842 Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure Info ADI 100 μL 565 €
GEN2262969739 Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure Info ADI 100 μL 565 €
GEN8360369156 Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN] Info ADI 500 μg 333 €
GEN4028876635 Mouse Monoclonal Anti-Mouse/rat NOS-II/i-NOS peptide Info ADI 100 μL 565 €
GEN9857657413 Mouse i-NOS/NOS-II Control/blocking peptide # 2 Info ADI 100 μg 188 €
GEN8080920330 Mouse NOS-II/i-NOS Control/blocking peptide # 1 Info ADI 100 μg 188 €
GEN8296073811 Human Iceberg control (blocking) peptide Info ADI 100 μg 188 €
GEN1734249013 Gliadin peptide, Clone: 314-02, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN7755693416 Gliadin peptide, Clone: 314-01, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN4083018784 Amyloid ß Peptide [10-16], Clone: 310-08, Mouse Monoclonal antibody-Human;ELISA Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN8897148962 Amyloid ß Peptide [5-9], Clone: 310-07, Mouse Monoclonal antibody-Human;ELISA Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN1526712061 Amyloid ß Peptide [10-16], Clone: 310-04, Mouse Monoclonal antibody-Human;ELISA Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN7191188489 Amyloid ß Peptide [9-10], Clone: 310-03, Mouse Monoclonal antibody-Human;ELISA Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN4260659941 Amyloid ß Peptide [10-16], Clone: 310-01, Mouse Monoclonal antibody-Human;ELISA Info ACCURATE MONOCLONALS 0.2mg 0 €
GEN2001243814 Carbostyril Peptide, Clone Cocktail, Mouse Monoclonal antibody- Info ACCURATE MONOCLONALS 0.2mg 0 €
GEN9488149038 Glucagon-like Peptide 1 (GLP-1 (7-36) amide), Clone: 147-13, Mouse Monoclonal antibody-; ELISA/IH Info ACCURATE MONOCLONALS 0.2mg 1775 €
GEN8014445315 Glucagon-like Peptide 1 (GLP-1 (7-36) amide), Clone: 147-12, Mouse Monoclonal antibody-; ELISA/IH, Biotin Info ACCURATE MONOCLONALS 50 ug 1405 €
GEN8863664732 Glucagon-like Peptide 1 (GLP-1 (7-36) amide), Clone: 147-12, Mouse Monoclonal antibody-; ELISA/IH Info ACCURATE MONOCLONALS 0.2mg 1775 €
GEN5767875613 Glucagon-like Peptide 1 (GLP-1 (7-36) amide), amidated C-terminal region, NO X w/GLP-1 (7-37), Clone: 147-08, Mouse Monoclonal antibody-; ELISA/IH, Biotin Info ACCURATE MONOCLONALS 50 ug 1405 €
GEN5855340668 Glucagon-like Peptide 1 (GLP-1 (7-36) amide), amidated C-terminal region, NO X w/GLP-1 (7-37), Clone: 147-08, Mouse Monoclonal antibody-; ELISA/IH Info ACCURATE MONOCLONALS 0.2mg 1775 €
GEN1813725325 Glucagon-Like Peptide-1 (GLP-1), 7-37, amide, all forms including precursor, Clone: 011-07, Mouse Monoclonal antibody-; ELISA/IH Info ACCURATE MONOCLONALS 0.2mg 0 €
GEN7127340798 Glucagon-like Peptide 1 (GLP-1 (7-36) amide), amidated C-terminal region, NO X w/GLP-1 (7-37), Clone: 147-06, Mouse Monoclonal antibody-; ELISA/IH, Biotin Info ACCURATE MONOCLONALS 50 ug 1405 €
GEN2374178980 Glucagon-Like Peptide-1 (GLP-1), 7-37, amide, amidated C-terminal region, NO X w/GLP-1 (7-37), Clone: 011-06, Mouse Monoclonal antibody-; ELISA/IH Info ACCURATE MONOCLONALS 0.2mg 1775 €
GEN4847983605 Glucagon-Like Peptide-1 (GLP-1), 1-36, amide, N-terminal region (residues 1-6), NO X w/GLP-1 (7-36) amide or (7-37) amide, Clone: 011-05, Mouse Monoclonal antibody-; ELISA Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN7456207183 Glucagon-Like Peptide-2 (GLP-2), NO X w/amino acids 1-11, Clone: 006-03, Mouse Monoclonal antibody-Human; ELISA Info ACCURATE MONOCLONALS 0.2mg 0 €
GEN2615853742 Glucagon-Like Peptide-2 (GLP-2), Clone: 006-02, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN3165678617 Mouse Hexokinase 1-4 (HXK1-IV) Control/blocking peptide Info ADI 100 μg 188 €
GEN3289616288 Mouse Hexokinase 4/GCK (HXK-IV) Control/blocking peptide Info ADI 100 μg 188 €
GEN6039835388 Mouse Hexokinase 3 (HXK-III) Control/blocking peptide Info ADI 100 μg 188 €
GEN8789012925 Mouse Hexokinase 2 (HXK-II) Control/blocking peptide Info ADI 100 μg 188 €
GEN6185005720 Mouse Hexokinase 1 (HXK-I) Control/blocking peptide Info ADI 100 μg 188 €
GEN9808164909 Human/rat HSP90 (K69) non-acetylated peptide # 2 Info ADI 100 μg 188 €
GEN4424450702 Human/rat HSP90 (acK69) acetylated peptide # 1 Info ADI 100 μg 188 €
GEN5840266050 Human/rat HSP90 (K558) non-acetylated peptide # 1 Info ADI 100 μg 188 €
GEN9843202966 Human/rat HSP90 (acK558) acetylated peptide # 1 Info ADI 100 μg 188 €
GEN4526529921 Human/rat HSP90 (K294) non-acetylated peptide # 2 Info ADI 100 μg 188 €
GEN9736441949 Human/rat HSP90 (acK294) acetylated peptide # 1 Info ADI 100 μg 188 €
GEN9142656149 Human/rat HSP90 (K100) non-acetylated peptide # 2 Info ADI 100 μg 188 €
GEN6345318692 Human/rat HSP90 (acK100) acetylated peptide # 2 Info ADI 100 μg 188 €
GEN9634373598 Anti-Human/mouse/rat HSP90 beta (hsp90B1) peptide IgG, aff pure Info ADI 100 μL 565 €
GEN7475266852 Rabbit Anti-Human/mouse/rat HSP90 alpha (hsp90AB1) peptide IgG, aff pure Info ADI 100 μL 565 €
GEN5557754042 Rabbit Anti-Human/mouse/rat HSP90 (hsp90A/HSP90AA1/LAP2/HSPC1) peptide IgG, aff pure Info ADI 100 μL 565 €
GEN3601124796 Rabbit Anti-human/mouse/rat Heat Shock Protein 70 (hsp70/Dnak) peptide (CT) IgG, aff pure Info ADI 100 μL 565 €
GEN8230551757 Heat shock protein (M. bovis HSP65; 243-255) indicator peptide in HLA-DQ2 binding assays (KPLLIIAEDVEGEY, MW:1588.8) Info ADI 1 mg 173 €
GEN2725276938 Heat shock protein (M. leprae HSP65; 343-355) P61 peptide (RVAQIRTEIENSD, MW:1530.7) Info ADI 1 mg 173 €
GEN7229698516 Heat shock protein (M. leprae/M. tuberculosis HSP65; 417-429) P38 peptide (AGGGVTLLQAAPALD, MW:1353.5) Info ADI 1 mg 173 €
GEN1425118350 Heat shock protein (M. leprae HSP65; 417-429) specific P62 peptide (LLQAAPALDKLKL, MW:1393.7) Info ADI 1 mg 173 €
GEN5027611635 Human 8-Oxoguanine DNA Glycosylase (hOGG1) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN4490594384 Rat Heme Oxygenase 3 (HO-3) Control/blocking peptide Info ADI 100 μg 188 €
GEN4057346152 Human Heme Oxygenase 1 (HO-2/1) Control/blocking peptide # 3 Info ADI 100 μg 188 €
GEN7807829045 Rat Heme Oxygenase 1 (HO-2) Control/blocking peptide # 2 Info ADI 100 μg 188 €
GEN9206347148 Rat Heme Oxygenase 1 (HO-2) Control/blocking peptide # 1 Info ADI 100 μg 188 €
GEN7748240479 Rat Heme Oxygenase 1 (HO-1) Control/blocking peptide Info ADI 100 μg 188 €
GEN3422968402 Purified his-tag peptide (His)6 or His-tag peptide Info ADI 100 μg 173 €
GEN9251445874 Mouse Hypoxia Inducible Factor-2 alpha (HIF2a), Control/blocking peptide # 1 Info ADI 100 μg 188 €
GEN3564723036 Rat Hereditary hemochromatosis protein (HFE/HLA-H) control/blocking peptide #2 Info ADI 100 μg 188 €
GEN3622154413 Rat Hereditary hemochromatosis protein (HFE/HLA-H) control/blocking peptide #1 Info ADI 100 μg 188 €
GEN7789102344 Rabbit Anti-Latex Allergen Hevein (Hev b 6.02) Hevein peptide Info ADI 100 μL 536 €
GEN5956130662 Latex Allergen Hevein (Hev b 6.02) Control/blocking peptide (HEVIN11) Info ADI 100 μg 188 €
GEN1671969218 Rabbit Anti-Latex Allergen Hevein (Hev b 6.02) Hevein peptide IgG, aff pure Info ADI 100 μg 565 €
GEN3560294169 Hev-b1 Control/blocking peptide (HEVB11) Info ADI 100 μg 188 €
GEN2588675158 HER2 multi peptide, (42-56,98-114,328-345); vaccine candidate Info ADI 5 mg 623 €
GEN7966769667 HER2 multi peptide, (776-790,927-941,1116-1180); vaccine candidate Info ADI 5 mg 768 €
GEN2902865552 HER2 multi peptide, (369-386, 688-703,971-984); vaccine candidate Info ADI 5 mg 623 €
GEN4151131363 HER2 peptide, (776 – 790 fused with LRMK, C-Term ), GP2 vaccine candidate Info ADI 5 mg 333 €
GEN6572630094 HER2 peptide, (654 – 662), GP2 vaccine candidate Info ADI 5 mg 260 €
GEN3106685665 HER2 peptide, cyclic, (613-626, cys-cys disulphide bond); vaccine candidate Info ADI 5 mg 405 €
GEN3676532980 HER2 peptide, cyclic, (597-626, cys-cys disulphide bond) vaccine candidate Info ADI 5 mg 478 €
GEN7352697908 Rabbit Anti-HER2 peptide IgG (cyclic 597-626 vaccine candidate) Aff pure Info ADI 100 u 565 €
GEN3882475630 HER2 peptide, cyclic, (585-598, cys-cys disulphide bond); vaccine candidate Info ADI 5 mg 405 €
GEN7544008365 HER2 peptide, cyclic, (563-598, cys-cys disulphide bond); vaccine candidate Info ADI 5 mg 550 €
GEN5149831818 HER2 peptide, (369 –377), E75 vaccine candidate Info ADI 5 mg 260 €
GEN5594715074 Rabbit Anti-HER2 peptide IgG (cyclic 367-37; E75 vaccine candidate) Aff pure Info ADI 100 μL 565 €
GEN7360399325 Mouse Hephaestin (Hp) control/blocking peptide Info ADI 100 μg 188 €
GEN2142711711 Mouse Hepcidin (HEPC) purified, 25-aa peptide (oxidized), Biotinylated Info ADI 100 μg 333 €
GEN7105296678 Mouse Hepcidin (HEPC) purified, 25-aa peptide (oxidized) Info ADI 100 μg 260 €
GEN5531246607 Human Hepcidin (HEPC) purified, 20-aa peptide (oxidized) Info ADI 100 μg 260 €
GEN2511188305 Human Hepcidin (HEPC) purified, 25-aa peptide (oxidized) Info ADI 5 mg 2878 €
GEN9891980951 Human Hepcidin (HEPC) purified, 25-aa peptide (oxidized) Info ADI 1000 μg 840 €
GEN1335543734 Human Hepcidin (HEPC) purified, 25-aa peptide (oxidized) Info ADI 100 μg 260 €
GEN5899688620 Mouse Pro-Hepcidin (Pro-Hepc) control/blocking peptide # 5 Info ADI 100 μg 188 €
GEN4724824439 Human Pro-Hepcidin (Pro-Hepc) control/blocking peptide # 4 Info ADI 100 μg 188 €
GEN8838049853 Mouse/Human Hepcidin-25 control/blocking peptide # 3 Info ADI 100 μg 188 €
GEN2158815915 Human Hepcidin (20-25 hepc) control/blocking peptide # 2 Info ADI 100 μg 188 €
GEN4874267100 Mouse Hepcidin (20-25 hepc) control/blocking peptide # 1 Info ADI 100 μg 188 €
GEN9362288728 Human HE2 gamma Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN9849798338 Human HE2 beta Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN8008810733 Human HE2 alpha Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN7056930240 Human HE2 Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN4034915792 Human Alpha Defensin 6 (NP-6) control/blocking peptide #1 Info ADI 100 μg 188 €
GEN4054964333 Human Alpha Defensin 5 (NP-5),control/blocking peptide #1 Info ADI 100 μg 188 €
GEN6976472829 Human Alpha Defensin 4 (NP-4) control/blocking peptide #1 Info ADI 100 μg 188 €
GEN2619595317 Human Alpha Defensin 1-3 (NP1-3/hNP1-3)control/blocking peptide #1 Info ADI 100 μg 188 €
GEN1991686646 Human Hyperpolarization-activated Cyclic Nucleotide-gated channel 1 (HCN1-pore) Control/blocking peptide Info ADI 100 μg 188 €
GEN8229574015 Rat Hyperpolarization-activated Cyclic Nucleotide-gated channel 4 (HCN4) Control/blocking peptide Info ADI 100 μg 188 €
GEN2567084088 Mouse Hyperpolarization-activated Cyclic Nucleotide-gated channel 3 (HCN3) Control/blocking peptide Info ADI 100 μg 188 €
GEN7294984395 Human Hyperpolarization-activated Cyclic Nucleotide-gated channel 2 (HCN2) Control/blocking peptide Info ADI 100 μg 188 €
GEN9171039046 Human Hyperpolarization-activated Cyclic Nucleotide-gated channel 1 (HCN1) Control/blocking peptide Info ADI 100 μg 188 €
GEN2606189907 Purified synthetic Human beta-Defensin 4 (BD-4/hBD-4) full length peptide (50 aa, >95%, Cys6-Cys33; Cys13-Cys27 and Cys17-34) Info ADI 25 μg 478 €
GEN2601404577 Purified synthetic Human beta-Defensin 4 (BD-4/hBD-4) full length peptide (50 aa, >95%, Cys6-Cys33; Cys13-Cys27 and Cys17-34) Info ADI 100 μg 913 €
GEN8504004336 Purified synthetic Human beta-Defensin 3 (BD-3/hBD-3) full length peptide (45 aa) Info ADI 25 μg 478 €
GEN5727932510 Purified synthetic Human beta-Defensin 3 (BD-3/hBD-3) full length peptide (45 aa) Info ADI 100 μg 913 €
GEN5248931246 Recombinant (E.Coli), purified, Human beta-Defensin 3 (BD-3/hBD-3, full length peptide (45 aa), biologically active Info ADI 1000 μg 7155 €
GEN1508037656 Recombinant (E.Coli), purified, Human beta-Defensin 3 (BD-3/hBD-3, full length peptide (45 aa), biologically active Info ADI 100 μg 2588 €
GEN2671237229 Recombinant (E.Coli), purified, Human beta-Defensin 3 (BD-3/hBD-3, full length peptide (45 aa), biologically active Info ADI 10 μg 405 €
GEN5577423798 Human beta-Defensin 3 (BD-3) control/blocking peptide #1 Info ADI 100 μg 188 €
GEN9991557726 Recombinant (E. coli), purified, Human beta-Defensin 2 (BD-2/hBD-2) full length peptide (41 aa), biologically active Info ADI 1000 μg 7155 €
GEN2846565845 Recombinant (E. coli), purified, Human beta-Defensin 2 (BD-2/hBD-2) full length peptide (41 aa), biologically active Info ADI 100 μg 2588 €
GEN5798833381 Recombinant (E. coli), purified, Human beta-Defensin 2 (BD-2/hBD-2) full length peptide (41 aa), biologically active Info ADI 10 μg 405 €
GEN1775159297 Human beta-Defensin 2 (BD-2/hBD-2) full length synthetic peptide (41 aa, linear, no-disulfides); note: replaces HBD22-P. Info ADI 100 μg 333 €
GEN3504502614 Human beta-Defensin 2 (BD-2/hBD-2)control/blocking peptide #1 Info ADI 100 μg 188 €
GEN8442264044 Purified synthetic Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa) Info ADI 25 μg 478 €
GEN3441554977 Purified synthetic Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa) Info ADI 100 μg 913 €
GEN2317710284 Recombinant (E. coli), purified, Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa), biologically active Info ADI 1000 μg 6575 €
GEN6655599989 Recombinant (E. coli), purified, Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa), biologically active Info ADI 100 μg 2298 €
GEN2151753825 Recombinant (E. coli), purified, Human beta-Defensin 1 (BD-1/hBD-1) full length peptide (36 aa), biologically active Info ADI 10 μg 449 €
GEN5815375753 Human beta-Defensin 1 (BD-1/hBD-1) full length (36 aa, oxidized) synthetic peptide; note: replaces HBD13-P Info ADI 100 μg 333 €
GEN3119783314 Human beta-Defensin 1 (BD-1/hBD-1) control/blocking peptide #1 Info ADI 100 μg 188 €
GEN5035560784 Hemeagglutinin fusion epitope (HA-tag) Control/blocking peptide#1 Info ADI 1 mg 304 €
GEN1574160780 Hemeagglutinin fusion epitope (HA-tag) Control/blocking peptide#1 Info ADI 100 μg 188 €
GEN6897139106 Hemeagglutinin fusion epitope (HA-tag) Control/blocking peptide#1 Info ADI 100 μg 188 €
GEN6542666096 Human histamine receptor 4 (H4R) control (blocking) peptide #1 Info ADI 100 μg 188 €
GEN9646374732 Human histamine receptor 3 (H3R) control (blocking) peptide #2 Info ADI 100 μg 188 €
GEN7231688858 Rat histamine receptor 3 (H3R) control (blocking) peptide #1 Info ADI 100 μg 188 €
GEN2769914650 Human histamine receptor 2 (H2R) control (blocking) peptide #2 Info ADI 100 μg 188 €
GEN3870192680 Rat histamine receptor 2 (H2R) control (blocking) peptide #1 Info ADI 100 μg 188 €
GEN5914291998 Human histamine receptor 1 (H1R) control (blocking) peptide #2 Info ADI 100 μg 188 €
GEN1770021127 Rat histamine receptor 1 (H1R) control (blocking) peptide #1 Info ADI 100 μg 188 €
GEN6477238722 PTGER1 peptide sequence Info GENWAYS 1 vial 392 €
GEN6297487142 Testosterone-3-BSA Conjugate peptide sequence Info GENWAYS 1 vial 474 €
GEN1892495214 C- peptide sequence (Proinsulin) antibody Info GENWAYS 1 vial 623 €
GEN8898651194 Clostridium botulinum Toxin A (a.a. 1280-1292) peptide sequence Info GENWAYS 1 vial 727 €
GEN1514733014 Clostridium botulinum Toxin B (a.a. 1278-1291) peptide sequence Info GENWAYS 1 vial 727 €
GEN7481627845 Clostridium botulinum Toxin E (a.a. 2-17) peptide sequence Info GENWAYS 1 vial 727 €
GEN6223836967 Synaptosomal protein 25kDa (SNAP-25), (a.a. 183-197) peptide sequence Info GENWAYS 1 vial 727 €
GEN6904110328 C- peptide sequence I & II antibody (N-terminusinal) Info GENWAYS 1 vial 777 €
GEN3892659075 C- peptide sequence I & II antibody (C-terminusinal) Info GENWAYS 1 vial 777 €
GEN5861729089 pro-Brain Natriuretic peptide sequence antibody (N-terminus) Info GENWAYS 1 vial 1074 €
GEN6888080109 Double Stranded DNA (dsDNA) plasmid peptide sequence Info GENWAYS 1 vial 2108 €
GEN8836294725 pro-Brain Natriuretic peptide sequence (proBNP), glycosylated, recombinant protein Info GENWAYS 1 vial 5138 €
GEN5522561083 Pig Neuro peptide sequence Y antibody Info GENWAYS 1 vial 747 €
GEN9029735819 Parathyroid Hormone Related peptide sequence antibody Info GENWAYS 1 vial 763 €
GEN6457584358 SYNTHETIC HUMAN GLUCAGON-LIKE peptide sequence 2 protein Info GENWAYS 1 vial 383 €
GEN7437199558 biotin conjugatedylated Mono-methylated K9 Histone H3 peptide sequence substrate Info GENWAYS 1 vial 434 €
GEN7924298671 biotin conjugatedylated [Lys(Me1)27] Histone H3 peptide sequence Substrate (21-44) Info GENWAYS 1 vial 434 €
GEN7023734214 PTGER3 peptide sequence Info GENWAYS 1 vial 406 €
GEN7211915390 6HIS peptide sequence antibody Info GENWAYS 1 vial 568 €
GEN2338256111 antibody to or anti- Neuro peptide sequence Y receptor type 5 antibody Info GENWAYS 1 vial 602 €
GEN3236804436 Neuropeptide Y (3-36) Human Info GENWAYS BULK bulk 0 €
GEN5279634060 Ikaprabbit polyclonal-alpha (Phospho-Tyr42) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6252975582 FMRF-Like peptide sequence from Snail Helix aspersa Info GENWAYS 1 vial 198 €
GEN5137981136 Mouse Anti FLAG peptide, Antibody Info GENWAYS BULK bulk 0 €
GEN2929111405 Tau (Phospho-Ser404) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2045831616 Tau (Phospho-Ser235) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1408030011 Vasoactive Intestinal peptide sequence antibody Info GENWAYS 1 vial 417 €
GEN1408635388 Peptide YY (PYY) (3-36) Human Info GENWAYS BULK bulk 0 €
GEN9561135093 mTOR(Phospho-Ser2448) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4432161835 DNA PKcs (Phospho-Thr2609) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1653911428 antibody to or anti- Neuro peptide sequences B/W receptor type 1 antibody Info GENWAYS 1 vial 602 €
GEN4643086440 JAK2 (Phospho-Tyr1007) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2198173148 Inhibitor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Kinase Gamma (IKBKG) Rabbit antibody to or anti-Human Polyclonal (aa2-13) Antibo Info GENWAYS 1 vial 602 €
GEN4270469448 Inhibitor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Kinase Gamma (IKBKG) Rabbit antibody to or anti-Human Polyclonal (aa385-399) Ant Info GENWAYS 1 vial 602 €
GEN4414899777 Zap-70 (Phospho-Tyr493) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2944197901 antibody to or anti- Glucagon-like peptide sequence 2 receptor antibody Info GENWAYS 1 vial 602 €
GEN6580646792 CDC2 (Phospho-Thr161) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9462332702 Atrial Natriuretic peptide sequence antibody Info GENWAYS 1 vial 989 €
GEN5456193955 ENDOTHELIAL MONOCYTE ACTIVATING POLY peptide sequence II (EMAP II), antibody Info GENWAYS 1 vial 671 €
GEN6211911547 C- peptide sequence antibody Info GENWAYS 1 vial 493 €
GEN2282405655 Glucagon-Like Peptide II (GLP-2) Rat Info GENWAYS BULK bulk 0 €
GEN9391551166 C- peptide sequence Info GENWAYS 1 vial 614 €
GEN9588192501 EGFR (phospho-Tyr1110) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6316630773 ATM (Phospho-Ser1981) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7344411636 PKD/PKC (Phospho-Ser738) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9306251489 Recombinant Human Endothelial-Monocyte Activating Polypeptide II Info GENWAYS BULK bulk 0 €
GEN2972423978 MARCKS (Phospho-Ser158) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9648758206 LIMK2 (Phospho-Thr505) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7272343157 Pituitary Adenylate Cyclase antibody (Activating Polyl peptide sequence) Info GENWAYS 1 vial 470 €
GEN4506241360 peptide sequence F Bovine Info GENWAYS 1 vial 429 €
GEN9772614242 antibody to or anti- Integrin B 1 (fibronectin Receptor B Poly peptide sequence Antigen CD29 Includes MDF2 MSK12) (ITGB1) Human antibody Info GENWAYS 1 vial 1053 €
GEN5349109769 Brain Natriuretic Peptide (BNP) (1-32) Rat Info GENWAYS BULK bulk 0 €
GEN4046418994 Anorexigenic peptide sequence Info GENWAYS 1 vial 198 €
GEN9454615758 Catch-Relaxing peptide sequence (CARP) Info GENWAYS 1 vial 383 €
GEN2767324956 HIV-1 TAT Protein Peptide Info GENWAYS BULK bulk 0 €
GEN3673692668 Met (Phospho-Tyr1349) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7239949972 Estrogen Receptor-alpha (Phospho-Ser167) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8680748121 Caveolin-1 (Phospho-Tyr14) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1440325674 Prolactin Releasing Peptide (12-31) Human Info GENWAYS BULK bulk 0 €
GEN5558073825 Tau (Phospho-Ser396) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6598712543 Fibrino peptide sequence A antibody Info GENWAYS 1 vial 694 €
GEN9893891668 Sodium Channel Voltage-Gated Type V Alpha Poly peptide sequence (Scn5a) Goat antibody to or anti-Human Polyclonal (Internal) antibody Info GENWAYS 1 vial 648 €
GEN8251583439 Rat C- peptide sequence antibody Info GENWAYS 1 vial 532 €
GEN2148173045 CD74 Antigen (invariant Poly peptide sequence Of Major Histocompatibility Complex Class II Antigen-associated) (CD74) Mouse antibody to or anti-Human Mo Info GENWAYS 1 vial 648 €
GEN4560811233 ASK1 (Phospho-Ser966) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4792001540 C- peptide sequence Info GENWAYS 1 vial 429 €
GEN6971291316 Paxillin (Phospho-Tyr118) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8271426805 Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide Human (Urodilatin) Info GENWAYS BULK bulk 0 €
GEN4102114838 antibody to or anti- Pituitary adenylate cyclase-activating poly peptide sequence type I receptor antibody Info GENWAYS 1 vial 602 €
GEN9718132236 Histone H3 peptide sequence (1-λ1) Info GENWAYS 1 vial 377 €
GEN3353542178 STAT1 (Phospho-Ser727) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2129991168 biotin conjugatedylated Histone H3 peptide sequence (1-λ1) Info GENWAYS 1 vial 434 €
GEN9978351708 Pancreatic Polypeptide Rat Info GENWAYS BULK bulk 0 €
GEN7000615098 UCP5 Blocking peptide sequence Rat Info GENWAYS 1 vial 1110 €
GEN4165630023 CD3E Antigen Epsilon Poly peptide sequence (TiT3 Complex) (CD3E) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody Info GENWAYS 1 vial 648 €
GEN9773106104 Raf1 (Phospho-Ser259) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9616438398 FKHRL1 (Phospho-Ser253) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN3617665122 Nuclear Factor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Inhibitor Alpha (NFKBIA) Rabbit antibody to or anti-Human Polyclonal (C-Ter Info GENWAYS 1 vial 602 €
GEN3421918549 IGF-1R (Phospho-Tyr1165/Tyr1166) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8141635641 PAK1(Phospho-Thr212) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7592520414 biotin conjugatedylated Di-methylated R3 Histone H4 peptide sequence substrate Info GENWAYS 1 vial 434 €
GEN8797938699 Tyrosine 3-Monooxygenase B Poly peptide sequence (YWHAB) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody Info GENWAYS 1 vial 648 €
GEN1134596401 Chk2 (Phospho-Ser516) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2580882673 p62Dok(phospho-Tyr362) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN5860063187 STAT5A (Phospho-Tyr694) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8714197594 Integrin B 1 (fibronectin Receptor B Poly peptide sequence Antigen CD29 Includes MDF2 MSK12) (ITGB1) Rabbit antibody to or anti-Human Polyclona Info GENWAYS 1 vial 602 €
GEN7444880192 antibody to or anti- Pancreatic Poly peptide sequence antibody Info GENWAYS 1 vial 786 €
GEN5948439177 ATF2 (Phospho-Thr69 or 51) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1178192546 B-Catenin (Phospho-Thr41/Ser45) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4975408860 antibody to or anti- Neuro peptide sequence Y receptor type 4 antibody Info GENWAYS 1 vial 602 €
GEN7516574326 Fibrino peptide sequence A antibody Info GENWAYS 1 vial 417 €
GEN5582072814 IRS-1 (Phospho-Ser639) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6535667356 P16 peptide sequence 6 (84-103) Info GENWAYS 1 vial 348 €
GEN3695421899 CaMKII (Phospho-Thr286) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6525564285 Ezrin(Phospho-Tyr353) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9752742993 Progesterone Receptor (Phospho- Ser190) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6184048630 C peptide sequence antibody Info GENWAYS 1 vial 394 €
GEN5522958569 Inhibitor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Kinase Gamma (IKBKG) Rabbit antibody to or anti-Human Polyclonal (aa400-416) Ant Info GENWAYS 1 vial 602 €
GEN5836828993 Estrogen Receptor-alpha (Phospho-Ser118) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7393901609 Peptide Standard 1 Info GENWAYS BULK bulk 0 €
GEN2340063218 antibody to or anti- Neuro peptide sequence Y receptor type 5 antibody Info GENWAYS 1 vial 602 €
GEN4388536057 MEK1 (Phospho-Ser221) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4350700322 NEURO peptide sequence TYROSINE Info GENWAYS 1 vial 348 €
GEN6974964215 Chk2 (Phospho-Thr68) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8006200042 Neuro peptide sequence Y antibody Info GENWAYS 1 vial 532 €
GEN5183450552 GHSR peptide sequence Info GENWAYS 1 vial 313 €
GEN6977885169 Calcitonin Gene Related Peptide II Rat Info GENWAYS BULK bulk 0 €
GEN6575623087 NFkaprabbit polyclonal-p65 (Phospho-Thr435) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2669982829 Amylin peptide sequence, antibody Info GENWAYS 1 vial 324 €
GEN6251229510 antibody to or anti- Glucagon-Like peptide sequence 1 Receptor (GLP1R) antibody Info GENWAYS 1 vial 602 €
GEN8217341196 Fibrino peptide sequence A, antibody Info GENWAYS 1 vial 971 €
GEN9217881129 Src (Phospho-Tyr529) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6755712624 p70 S6 Kinase (Phospho-Thr421) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9645015922 NFkaprabbit polyclonal-p65 (Phospho-Ser468) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN5000446417 NFkaprabbit polyclonal-p100/p52 (Ser869) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN3220999838 Fibrinogen-binding peptide sequence Info GENWAYS 1 vial 209 €
GEN4341436897 antibody to or anti- Parathyroid hormone/parathyroid hormone-related peptide sequence receptor antibody Info GENWAYS 1 vial 602 €
GEN6128568582 C peptide sequence antibody Info GENWAYS 1 vial 394 €
GEN3422683878 Glucagon-Like Peptide II-Arg (GLP-2-Arg) Human Info GENWAYS BULK bulk 0 €
GEN2499216365 OVA Peptide (323-339) Info GENWAYS BULK bulk 0 €
GEN1428619793 HSP27 (Phospho-Ser15) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7077918164 Glucose Transporter 4 (GLUT-1) Control/Blocking peptide sequence Mouse Info GENWAYS 1 vial 429 €
GEN4070393468 PKD/PKC (Phospho-Ser910) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6017241839 Akt2 (Phospho-Ser474) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN3156583452 PKC-B(Phospho-Thr642) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8141480498 P38 MAPK(Phospho-Thr180) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1558188348 C peptide sequence antibody Info GENWAYS 1 vial 394 €
GEN4835882218 Fibrino peptide sequence A antibody Info GENWAYS 1 vial 694 €
GEN1945625013 GSK3-B (Phospho-Ser9) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9676262741 Calcitonin Gene Related Peptide Rat Info GENWAYS BULK bulk 0 €
GEN4034659455 Rat C- peptide sequence II antibody Info GENWAYS 1 vial 532 €
GEN6294262222 CD74 Antigen (invariant Poly peptide sequence Of Major Histocompatibility Complex Class II Antigen-associated) (CD74) Mouse antibody to or anti-Human Mo Info GENWAYS 1 vial 602 €
GEN7281962506 IGF-1R (Phospho-Tyr1161) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9188688995 p56Dok-2 (Phospho-Tyr299) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7078161725 Peptide B Bovine Info GENWAYS BULK bulk 0 €
GEN1841522266 CTD (carboxy-terminusinal Domain RNA Polymerase II Poly peptide sequence A) Phosphatase Subunit 1 (CTDP1) Rabbit antibody to or anti-Human Polyclonal (N-T Info GENWAYS 1 vial 602 €
GEN2904303123 S6 Ribosomal protein (Phospho- Ser235) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9094944244 Integrin, Alpha X (Antigen CD11C (P150), Alpha Poly peptide sequence) (ITGAX) Rabbit antibody to or anti-Human Polyclonal antibody Info GENWAYS 1 vial 602 €
GEN2541270891 c-Jun (Phospho-Thr239) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2864322358 biotin conjugatedylated Histone H3 peptide sequence (21-44) Info GENWAYS 1 vial 434 €
GEN6149290765 Zap-70 (Phospho-Tyr319) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7794816820 EGFR (Phospho-Tyr869) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9038324816 antibody to or anti- Neuro peptide sequence Y receptor type 1 antibody Info GENWAYS 1 vial 602 €
GEN5560094356 Ribosomal protein S6 Kinase 90kd Poly peptide sequence 1 (RSK1) (RPS6KA1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody Info GENWAYS 1 vial 602 €
GEN6813636672 Neuro peptide sequence Y Receptor Type 2 (NPY2R) Rabbit antibody to or anti-Human Polyclonal (aa350-400) antibody Info GENWAYS 1 vial 602 €
GEN4961799471 Nuclear Factor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Inhibitor Alpha (NFKBIA) Rabbit antibody to or anti-Human Polyclonal (Ser32 Info GENWAYS 1 vial 602 €
GEN1923925363 antibody to or anti- Neuro peptide sequence Y receptor type 4 antibody Info GENWAYS 1 vial 602 €
GEN7775291628 Renin Inhibitor peptide sequence Info GENWAYS 1 vial 198 €
GEN9367684305 BRAIN NATRIURETIC peptide sequence Info GENWAYS 1 vial 337 €
GEN1803691248 Peptide YY (PYY) Porcine Info GENWAYS BULK bulk 0 €
GEN7799126039 Islet Amyloid Poly peptide sequence (IAPP) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody Info GENWAYS 1 vial 602 €
GEN3322695635 Joining peptide sequence Rat Info GENWAYS 1 vial 324 €
GEN4780391036 antibody to or anti- Gastric inhibitory poly peptide sequence receptor antibody Info GENWAYS 1 vial 602 €
GEN8160966855 antibody to or anti- Glucagon-like peptide sequence 2 receptor antibody Info GENWAYS 1 vial 602 €
GEN6768564535 peptide sequence F-9 Info GENWAYS 1 vial 221 €
GEN9173773292 Calcitonin Gene Related Peptide (8-37) Rat Info GENWAYS BULK bulk 0 €
GEN8864611682 SMC1 (Phospho-Ser957) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6382673328 antibody to or anti- PACAP 38 (Pituitary adenylate cyclase activating peptide sequence) antibody Info GENWAYS 1 vial 1456 €
GEN5397225910 EGFR (Phospho-Tyr1197) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9708017398 Nuclear Factor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Inhibitor Alpha (NFKBIA) Rabbit antibody to or anti-Mouse Polyclonal (C-Ter Info GENWAYS 1 vial 602 €
GEN9659816511 Myc (Phospho-Thr58) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2313733699 Rat Brain Natriuretic peptide sequence antibody Info GENWAYS 1 vial 920 €
GEN1423171903 Dicarbonyl Reductase Immunizing peptide sequence Info GENWAYS 1 vial 308 €
GEN4135166888 Inhibitor Of Kappa Light Poly peptide sequence Gene Enhancer In B-cells Kinase Complex-associated protein (IKBKAP) Rabbit antibody to or anti-Human Poly Info GENWAYS 1 vial 602 €
GEN1857030121 MEK-2 (Phospho-Thr394) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8052392587 Octaneuro peptide sequence Info GENWAYS 1 vial 324 €
GEN3293559475 LIMK1 (Phospho-Thr508) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8207508519 antibody to or anti- Amyloid Precursor protein (APP) C-terminusinal peptide sequence antibody Info GENWAYS 1 vial 752 €
GEN9184917703 antibody to or anti- Neuro peptide sequence Y receptor type 4 antibody Info GENWAYS 1 vial 602 €
GEN8060339303 antibody to or anti- Vasoactive intestinal poly peptide sequence receptor 1 antibody Info GENWAYS 1 vial 602 €
GEN3138915776 Human NPR-B (a.a. 288-302) peptide sequence Info GENWAYS 1 vial 942 €
GEN4175415081 SYNTHETIC RAT CALCITONIN GENE RELATED peptide sequence Info GENWAYS 1 vial 337 €
GEN6500816573 DEAD (Asp-Glu-Ala-Asp) Box Poly peptide sequence 3 X-linked (DDX3X) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody Info GENWAYS 1 vial 602 €
GEN3413729709 JunD (Phospho-Ser255) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN8198028041 RelB (Phospho-Ser552) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4295767695 Presenilin-1 N-terminusinal peptide sequence Info GENWAYS 1 vial 463 €
GEN9161262508 AMPK1/AMPK2 (Phospho-Ser485/ Ser491) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9802701425 antibody to or anti- Calcitonin gene-related peptide sequence (CGRP) antibody Info GENWAYS 1 vial 1330 €
GEN2899399640 Pyk2 (Phospho-Tyr402) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4689839476 Integrin B 1 (fibronectin Receptor B Poly peptide sequence Antigen CD29 Includes MDF2 MSK12) (ITGB1) Rabbit antibody to or anti-Human Polyclona Info GENWAYS 1 vial 602 €
GEN9287719685 C- peptide sequence 96 well plate ELISA assay Info GENWAYS 1 vial 689 €
GEN5888088938 ALDH1B1 (aldehyde dehydrogenase 1 family, member B1) Blocking peptide sequence (the middle region of protein) Info GENWAYS 1 vial 301 €
GEN7955037701 Recombinant Human Myostatin-Propeptide Info GENWAYS BULK bulk 0 €
GEN2109471811 PLC 1 (Phospho-Tyr783) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN4198458478 antibody to or anti- Neuro peptide sequences B/W receptor type 2 antibody Info GENWAYS 1 vial 602 €
GEN7584197017 HER2 (Phospho-Tyr1248) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN7346027162 Glu-Glu peptide sequence antibody Info GENWAYS 1 vial 342 €
GEN1143103536 Eledoisin Related peptide sequence Info GENWAYS 1 vial 221 €
GEN2073581883 BAD (Phospho-Ser155) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9361199120 B-Catenin (Phospho-Ser33) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9282360360 BCL-XL (Phospho-Ser62) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2647297827 Neuro peptide sequence FF Morphine Modulating Neuro peptide sequence Info GENWAYS 1 vial 198 €
GEN9550596815 c-Abl (Phospho-Tyr412) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1640779500 CDK2 (Phospho-Thr160) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN6141618363 TRIP13 (thyroid hormone receptor interactor 13) Blocking peptide sequence (100ug) Info GENWAYS 1 vial 319 €
GEN2241852624 C- peptide sequence antibody Info GENWAYS 1 vial 486 €
GEN3622337220 Islet Amyloid Poly peptide sequence (IAPP) Mouse antibody to or anti-Human Monoclonal (aa29-37) (R10/99) antibody Info GENWAYS 1 vial 648 €
GEN1678584450 Monoclonal antibody to or anti-Cytokeratin peptide sequence 18 antibody antibody Info GENWAYS 1 vial 434 €
GEN5689188276 Monoclonal antibody to or anti-Cytokeratin peptide sequence 7 antibody antibody Info GENWAYS 1 vial 434 €
GEN6469976009 HER2 (Phospho-Tyr1221/Tyr1222) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1194853326 antibody to or anti- Neuro peptide sequence Y 1 Receptor (NPY1R) antibody Info GENWAYS 1 vial 1030 €
GEN7106146750 Dopamine Receptor 2 (DR2) Control peptide sequence Rat Info GENWAYS 1 vial 486 €
GEN7752811177 antibody to or anti- Prolactin-releasing peptide sequence receptor antibody Info GENWAYS 1 vial 602 €
GEN7060345499 Estrogen Receptor-alpha (Phospho-Ser106) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9787990867 NMDAR1 (Phospho-Ser896) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN1138821420 HER2 (Phospho-Tyr877) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9742290547 c-Jun (Phospho-Ser243) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN9753914643 Fibronectin CS1 Peptide Info GENWAYS BULK bulk 0 €
GEN6858506524 Erythromycin resistance peptide sequence Info GENWAYS 1 vial 406 €
GEN9416694941 PDK1 (Phospho-Ser241) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN2605202712 BCL-2 (Phospho-Ser70) antibody Blocking peptide sequence Info GENWAYS 1 vial 255 €
GEN3794153732 Calmodulin Binding peptide sequence 1 Info GENWAYS 1 vial 394 €
GEN9553690360 Human Glucagon Like Peptide-2 Info GENWAYS BULK bulk 0 €
GEN1424347176 peptide sequence E antibody Info GENWAYS 1 vial 532 €
GEN6406596197 C- peptide sequence antibody (Proinsulin) Info GENWAYS 1 vial 648 €
GEN7624744360 GPR65 peptide sequence Info GENWAYS 1 vial 313 €
GEN4765570159 Recombinant Human Transcription Elongation Factor B Polypeptide 2 Info GENWAYS BULK bulk 0 €
GEN4977632904 biotin conjugatedylated Di-methylated K9 Histone H3 peptide sequence substrate Info GENWAYS 1 vial 434 €
GEN7686611053 Myostatin Propeptide Recombinant Protein Info ZYAGEN 0.005 mg 256 €
GEN2006860276 TRIM24 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3016621989 N-RAS Peptide Info ZYAGEN 0.05 mg 204 €
GEN4255234178 B-raf Peptide Info ZYAGEN 0.05 mg 204 €
GEN8109240814 TLX3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN8951530451 TLX2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5383371625 TLX1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6241371957 GABARAP Peptide Info ZYAGEN 0.05 mg 204 €
GEN7107767109 RNF20 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5366643977 UNG2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN2064638524 DDX41 Peptide Info ZYAGEN 0.05 mg 204 €
GEN8369036826 DIS3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5246717619 KAT5 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1992090558 ULK2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4528555399 ULK1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5382709602 APO-E Peptide Info ZYAGEN 0.05 mg 204 €
GEN3029732587 GBP5 Peptide Info ZYAGEN 0.05 mg 204 €
GEN7150933475 CRTC2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN2008314499 KANK3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5533011906 KANK2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6079411786 KANK1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5821404864 TIAF Peptide Info ZYAGEN 0.05 mg 204 €
GEN9761445663 CNRIP1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5373630686 CISD2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5418742040 SLC27A6 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3381317752 PRRT2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN7923658129 WAC Peptide Info ZYAGEN 0.05 mg 204 €
GEN2376443539 TMEM135 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1898122561 ERRF2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3231106378 MTERFD3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6417761850 MTERFD2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3234977603 MTERFD1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN5258469110 MOSPD1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6121429470 SHISA4 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4918036517 SHISA3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1558636503 Nucleobindin-2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN7350563610 PRKCDBP Peptide Info ZYAGEN 0.05 mg 204 €
GEN7061565478 PTRF Peptide Info ZYAGEN 0.05 mg 204 €
GEN9684251009 SDPR Peptide Info ZYAGEN 0.05 mg 204 €
GEN1726882807 KREMEN2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6455772354 KREMEN1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4359438305 FOXA2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1654680094 FOXA1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1513128715 RC3H1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN8113737848 RRAS2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN9372029478 AGR2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1977971024 TNFSF4 Peptide Info ZYAGEN 0.05 mg 204 €
GEN7040483525 CCL17 Peptide Info ZYAGEN 0.05 mg 204 €
GEN2048717183 PIBF1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4254014276 CD59 Peptide Info ZYAGEN 0.05 mg 204 €
GEN9434901645 IL-15RA Peptide Info ZYAGEN 0.05 mg 204 €
GEN8661903435 IL-15 Peptide Info ZYAGEN 0.05 mg 204 €
GEN9696296704 GRIP1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4676412037 CCL4 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4738304745 NELF Peptide Info ZYAGEN 0.05 mg 204 €
GEN7465590889 CCNT1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN1151181491 TSC22D3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3524467426 CARM1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN2020334000 CCL2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN9059727639 PDGF-B Peptide Info ZYAGEN 0.05 mg 204 €
GEN3981599451 STAT3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4156674184 STAT1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN9965090187 TPT1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6682418270 PTGDR2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6551806268 VTCN1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4635867986 FOXP3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6238095380 TREM1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4244861694 BCL3 Peptide Info ZYAGEN 0.05 mg 204 €
GEN4571735467 IL-17RE Peptide Info ZYAGEN 0.05 mg 204 €
GEN1727965822 TRPV1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN8780167314 TYK2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN8875856240 Alpha-tubulin Peptide Info ZYAGEN 0.05 mg 204 €
GEN1719485258 JAKMIP2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN9555360831 JAKMIP1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6334344065 DHX36 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3224552057 SIDTR2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN7443881505 CRB2 Peptide Info ZYAGEN 0.05 mg 204 €
GEN3159624793 CRB1 Peptide Info ZYAGEN 0.05 mg 204 €
GEN6272775884 MECR Peptide Info ZYAGEN 0.05 mg 204 €

Subscribe to our Newsletter