Product Listing

GEN5740420399 Biotin-Atrial Natriuretic Peptide (1-28), human, porcine (AA: Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23)) (MW: 3308.8) ADI 1 mg 405 €

GEN7491771116 Gastrin Releasing Peptide-Lys(Biotin), human (AA:Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-Lys(Biotin)) (MW: 2859.3) ADI 1 mg 333 €

GEN6509108454 Recombinant Human Adenylate Kinase 2 GENWAYS BULK bulk 0 €

GEN3313488004 biotin conjugated labelled Affinity Purified antibody to or anti-RAT IgG (H&L) (RABBIT) (Min X Human Serum proteins) GENWAYS 1 x 1 vial 381 €

GEN5865054475 Galanin-Lys(Biotin), human (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin)) (MW: 3511.95) ADI 1 mg 333 €

GEN2956064093 antibody to or anti-HUMAN TRANSFERRIN antibody GENWAYS 1 x 1 vial 667 €

GEN7025009123 Rat antibody to or anti-Human IL-6, antibody GENWAYS 1 x 1 vial 591 €

GEN8278119933 [D-Ser14] - Humanin (HN) [Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-D-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-arg-Arg-Ala; MW: 2687.28] ADI 1 mg 260 €

GEN3477734103 Mouse antibody to or anti-Human CD33, antibody GENWAYS 1 x 1 vial 447 €

GEN8383960310 Human AGRP (87-132), human (AA: Ac-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr) (MW: 5243.17) ADI 1 mg 478 €

GEN5536572439 Human AGRP (54-82) (AA: Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg) (MW: 3282.5) ADI 1 mg 333 €

GEN2086267465 Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5) ADI 1 mg 260 €

GEN2161313028 Pro-Adrenomedullin N20, human (AA: Ala-Arg-Leu-Asp-Val-Ala-Ala-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2444.9) ADI 1 mg 188 €

GEN2802546224 Prepro-adrenomedullin (153 - 185), human (AA: Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu) (MW: 3219.6) ADI 1 mg 260 €

GEN3339571783 Adrenomedullin (1-12), human (AA: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg) (MW: 1513.7) ADI 5 mg 333 €

GEN4044725669 G protein-Coupled Receptor OGR1/GPR68 Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN7287103561 Biotin-ACTH (1-39), human (AA: Biotin-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe) (MW: 4767.47) ADI 1 mg 623 €

GEN5258781212 FDC - SP (61 - 85), human (AA: Phe-Pro-Trp-Phe-Arg-Arg-Asn-Phe-Pro-Ile-Pro-Ile-Pro-Glu-Ser-Ala-Pro-Thr-Thr-Pro-Leu-Pro-Ser-Glu-Lys) (MW: 2925.41) ADI 1 mg 260 €

GEN6376454894 FDC - SP (30 - 85), human ADI 1 mg 623 €

GEN5933084300 Rhodamine labelled Affinity Purified antibody to or anti-HUMAN IgA (alpha chain) (RABBIT) GENWAYS 1 x 1 vial 308 €

GEN8222723570 Corticotropin-Releasing Factor Receptor 1 (CRHR1) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2108896713 Mouse antibody to or anti-Human IgG3 (3 chain specificity), antibody GENWAYS 1 x 1 vial 539 €

GEN2697276530 [Tyr0]-Prepro-Atrial Natriuretic Factor (104-123) (human) [Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg; MW 2346.8] ADI 1 mg 188 €

GEN4657984855 HDAC-4, Active Human recombinant protein GENWAYS 1 x 1 vial 717 €

GEN3350720704 Prepro-Atrial Natriuretic Factor (104-123) (human) (AA: Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg) (MW: 2183.6) ADI 1 mg 188 €

GEN3171370781 Human Adiponectin 96 well plate ELISA assay, High Sensitivity GENWAYS 1 x 1 vial 845 €

GEN8800152687 Prepro-Atrial Natriuretic Factor (56-92) (human) (AA: Glu-Val-Val-Pro-Pro-Gln-Val-Leu-Ser-Glu-Pro-Asn-Glu-Glu-Ala-Gly-Ala-Ala-Leu-Ser-Pro-Leu-Pro-Glu-Val-Pro-Pro-Trp-Thr-Gly-Glu-Val-Ser-Pro-Ala-Gln-Arg) (MW: 3878.3) ADI 1 mg 405 €

GEN4785358385 Prepro-Atrial Natriuretic Factor (26-55) (human) (AA: Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp) (MW: 3508) ADI 1 mg 333 €

GEN6906425476 Prostaglandin E Synthase (PTGES) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2444613095 Atrial Natriuretic Factor (4-28) (human) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 )) (MW: 2724.06) ADI 0,5 mg 333 €

GEN5742731542 Atrial Natriuretic Factor (3-28) (human) (AA: Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys5-Cys21 )) (MW: 2880.3) ADI 0,5 mg 333 €

GEN1506492899 Biotin-β-Endomorphin, human (AA: Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu) (MW: 3691.36) ADI 1 mg 333 €

GEN7283264883 Defensin-1 (human) HNP-1 (AA: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridges Cys2-Cys30, Cys4-Cys19, and Cys 9-29 )) (MW: 3442.1) ADI 1 mg 623 €

GEN4615857357 β-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22) ADI 1 mg 1428 €

GEN7527019766 Affinity Purified antibody to or anti-HUMAN IgG F(ab')2 (RABBIT) (Min X MOUSE Serum proteins) GENWAYS 1 x 1 vial 342 €

GEN9945376841 S100A10 Human GENWAYS BULK bulk 0 €

GEN5838378457 PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 1062.2) ADI 5 mg 260 €

GEN9175558594 PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 1403.71) ADI 5 mg 333 €

GEN7075256678 PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 2720.37) ADI 1 mg 260 €

GEN5890293227 Ac-PACAP-38 (human, mouse, ovine, porcine, rat) ADI 1 mg 478 €

GEN5853716127 MB Human GENWAYS BULK bulk 0 €

GEN2200444146 [Leu31,Pro34]-Peptide YY (human) [Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ala-Aib-Arg-Gln-Arg-Tyr-NH2; MW: 4207.73] ADI 1 mg 405 €

GEN8699276184 Pancreatic Polypeptide (31-36) (free acid) (human) ADI 5 mg 188 €

GEN2253811461 nudE Nuclear Distribution Gene E Homolog 1 (NDE1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN5472656563 Pancreatic Polypeptide (31-36) (human) ADI 5 mg 188 €

GEN9774136717 Pancreatic Polypeptide (human) ADI 1 mg 405 €

GEN7490971938 [Thr46]-Osteocalcin (45-49) (human) ADI 5 mg 188 €

GEN1542519493 Osteocalcin (45-49) (human) ADI 5 mg 188 €

GEN7334169772 [Tyr38,Phe42,46]-Osteocalcin (38-49) (human) ADI 5 mg 333 €

GEN6173817481 Osteocalcin (37-49) (human) ADI 5 mg 333 €

GEN1201990641 [Ala11, D-Leu15]-Orexin B (human) ADI 1 mg 333 €

GEN9500749360 Hypocretin (70-98) (human) ADI 1 mg 333 €

GEN5447160668 Biotin-Obestatin (human) ADI 1 mg 260 €

GEN1718555238 Myeloid/lymphoid Or Mixed-lineage Leukemia 5 (MLL5) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN8425542829 EGF Receptor (988-993) (phosphorylated) (human) ADI 1 mg 188 €

GEN1432516145 ERBB-4 Receptor protein Tyrosine Kinase (ERBB4) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN6422933495 Band 3 Protein (824-829) (human) ADI 5 mg 188 €

GEN6459083203 Damage-regulated Autophagy Modulator (DRAM) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN6884714283 Band 3 Protein (547-553) (human) ADI 5 mg 188 €

GEN8130759845 Ac-Gastrin Releasing Peptide (GRP) (20-26) (human, porcine, canine) ADI 5 mg 260 €

GEN5961060817 Gastrin Releasing Peptide (GRP) (14-27) (human, porcine, canine) ADI 5 mg 333 €

GEN3888358937 Minigastrin I (human) ADI 5 mg 333 €

GEN4877633568 Recombinant Human Vesicle-Associated Membrane Protein 4 GENWAYS BULK bulk 0 €

GEN3875289867 Gastrin I (1-14) (human) ADI 1 mg 188 €

GEN1298688369 Mouse antibody to or anti-Human Toll-like Receptor 2 (TLR2), antibody GENWAYS 1 x 1 vial 614 €

GEN6121184547 [Leu15]-Gastrin I (human) ADI 1 mg 260 €

GEN9508527595 Biotin-[Glu1]-Gastrin I (human) (phosphorylated) ADI 1 mg 260 €

GEN8985959683 Biotin-[Gln1]-Gastrin I (human) ADI 1 mg 260 €

GEN5915914882 Gastric Inhibitory Polypeptide (GIP, 6-30) amide (human) ADI 1 mg 260 €

GEN3055203479 PLGF-2 Human GENWAYS BULK bulk 0 €

GEN5492358938 Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) ADI 5 mg 188 €

GEN9371442636 Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) ADI 5 mg 188 €

GEN3608091274 Osteostatin amide (human) ADI 1 mg 260 €

GEN6916563652 Pneumadin (human) ADI 5 mg 333 €

GEN8508611752 Platelet Factor 4, PF4, PF4 (58-70) (human) ADI 5 mg 333 €

GEN7199486350 [Gln18]-Platelet Factor 4, PF4 (15-22) (human) ADI 5 mg 260 €

GEN1397039403 Kallmann Syndrome protein (KAL1) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2588223303 Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (NPY) (18-36) (human) ADI 1 mg 405 €

GEN6943432410 G protein-Coupled Receptor GPR133 Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN9503622253 [Leu31,Pro34]-Neuropeptide Y (NPY) (13-36) (human, rat) ADI 1 mg 260 €

GEN4883079843 Neuropeptide Y (NPY) (13-36), human ADI 1 mg 260 €

GEN6334462946 Endoglin (ENG) Rabbit antibody to or anti-Human Polyclonal (aa26-176) antibody GENWAYS 1 x 1 vial 602 €

GEN2550613043 Neuropeptide Y (NPY) (2-36) (human, rat) ADI 1 mg 333 €

GEN1216914428 Neuropeptide Y (NPY) (1-24) amide (human, rat) ADI 1 mg 260 €

GEN3997054278 ZAP70, Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN4682419672 [D-Trp32]-Neuropeptide Y (NPY) (human) ADI 1 mg 333 €

GEN8427087290 [Leu31,Pro34]-Neuropeptide Y (NPY) (human, rat) ADI 1 mg 333 €

GEN2880418549 Biotin-Neuropeptide Y (NPY) (human, rat) ADI 1 mg 333 €

GEN7160635643 Nesfatin-1 (human) ADI 1 mg 913 €

GEN2320803304 ALK/P80 Human GENWAYS BULK bulk 0 €

GEN9391607925 Proadrenomedullin (12-20) (human) ADI 5 mg 333 €

GEN7936944844 Proadrenomedullin (1-20) (human) ADI 1 mg 188 €

GEN6159569072 Proadrenomedullin (45-92) (human) ADI 1 mg 405 €

GEN6074209710 Adrenomedullin (Adrenomedullin (ADM/AM, 26-52) (human) ADI 1 mg 260 €

GEN4644941550 Adrenomedullin (Adrenomedullin (ADM/AM, 16-31) (human, pig) ADI 1 mg 333 €

GEN5945007671 Goat antibody to or anti-Human kappa ( chain specificity) GENWAYS 1 x 1 vial 770 €

GEN7045387911 [Leu116]-Prepro-Neuromedin U (NmU, 104-136) (human) ADI 1 mg 333 €

GEN8625827974 Prepro-Neuromedin U (NmU, 104-136) (human) ADI 1 mg 333 €

GEN1294697286 SDF-1a Human GENWAYS BULK bulk 0 €

GEN2010956100 Prepro-Neuromedin S (NMS, 70-103) (human) ADI 1 mg 333 €

GEN4007990334 P21-Activating Kinase (PAK1/PAK2/PAK3) Rabbit antibody to or anti-Human Polyclonal (pThr423) antibody GENWAYS 1 x 1 vial 602 €

GEN8132432641 Biotin-Neuromedin S (NMS, human) ADI 1 mg 1377 €

GEN9785440038 Neuromedin S (NMS, human) ADI 1 mg 333 €

GEN7196405680 Recombinant Human Neuronal Specific Enolase GENWAYS BULK bulk 0 €

GEN4579134179 Alkaline Phosphatase labelled Affinity Purified antibody to or anti-RAT IgG (H&L) (RABBIT) (Min X Human Serum proteins) GENWAYS 1 x 1 vial 408 €

GEN6455561283 cKit (V560G), Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN6917747931 Human Sclerostin protein Control/blocking peptide # 1 ADI 100 μg 188 €

GEN3610762314 Rabbit Anti-human Sclerostin protein ADI 100 μg 565 €

GEN1555771779 Lifeguard (KIAA0950) (FAIM2) Rabbit antibody to or anti-Human Polyclonal (aa1-50) antibody GENWAYS 1 x 1 vial 602 €

GEN3488829216 Human Superoxide Dismutase 3 (SOD3) control/blocking peptide ADI 100 μg 188 €

GEN6495591141 CK-20 Human GENWAYS BULK bulk 0 €

GEN8179955193 Rabbit Anti-human Superoxide Dismutase 3 (SOD3) IgG ADI 100 μg 565 €

GEN8332186718 Mouse Monoclonal Anti-human Superoxide Dismutase 2 (SOD2/MnSOD) protein IgG ADI 100 μL 565 €

GEN2187309513 Human Superoxide Dismutase 2 (SOD2/MnSOD)-GST fusion protein control for western ADI 100 μL 333 €

GEN4341885942 Sheep Anti-human Superoxide Dismutase 2 (SOD2) protein ADI 100 μL 565 €

GEN9879317272 Mouse Monoclonal Anti-human Superoxide Dismutase 1 (SOD1) protein ADI 100 μg 565 €

GEN3285579360 Recombinant purified human Superoxide Dismutase 1 (SOD1) protein control for WB ADI 100 μL 333 €

GEN2713148367 Centaurin Gamma 1 (AGAP2/CENTG1) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN3467075961 Sheep Anti-human Superoxide Dismutase 1 (SOD1) protein IgG ADI 100 μL 565 €

GEN9107007640 Octamer-binding protein Oct-1 (POU2F1) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN7765514303 Human Tissue Lysate (Normal) Human Stomach GENWAYS 1 x 1 vial 602 €

GEN5323028115 Rat antibody to or anti-Human IL-3, antibody GENWAYS 1 x 1 vial 591 €

GEN3367712600 recombinant HUMAN CYSTATIN C GENWAYS 1 x 1 vial 1163 €

GEN6773007681 Endothelial (CD141) Human/Rabbit, antibody GENWAYS 1 x 1 vial 1168 €

GEN4206737891 Purified Human Smith Antigen (Sm) WB +ve control ADI 100 μL 333 €

GEN3234089927 Affinity Purified antibody to or anti-HUMAN IgG (H&L) (RABBIT) (Min X MOUSE Serum proteins) GENWAYS 1 x 1 vial 315 €

GEN2257802552 Matrix Metalloproteinase 10 (MMP10/Stromelysin2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 648 €

GEN7969542810 Muscarinic Acetylcholine Receptor M3 (CHRM3) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2335300122 OT Human GENWAYS BULK bulk 0 €

GEN8787411437 Cell Division Cycle 27 (CDC27) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN6138646969 VEGFR-1 D5 Human GENWAYS BULK bulk 0 €

GEN2567145285 Tankyrase TRF1-interacting Ankyrin-related ADP-ribose Polymerase (TNKS) Mouse antibody to or anti-Human Monoclonal (19A449 ) antibody GENWAYS 1 x 1 vial 602 €

GEN4749424453 Activating Transcription Factor 2 (ATF2) Rabbit antibody to or anti-Human Polyclonal (Thr51) antibody GENWAYS 1 x 1 vial 602 €

GEN7539994004 Interleukin 1 Receptor-Associated Kinase 2 (IRAK2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN9943005528 ACTH (1-16) Human GENWAYS BULK bulk 0 €

GEN6208429718 Cyclin-Dependent Kinase 2 (CDK2) Rabbit antibody to or anti-Human Polyclonal (Thr160) antibody GENWAYS 1 x 1 vial 602 €

GEN5977968588 IL-7 Human GENWAYS BULK bulk 0 €

GEN2449884966 Recombinant Human Stathmin Like-2 GENWAYS BULK bulk 0 €

GEN4779881274 Nuclear Receptor Co-repressor 2 (NCOR2) Rabbit antibody to or anti-Human Polyclonal (aa994-1005) antibody GENWAYS 1 x 1 vial 648 €

GEN2470483584 CFL1 Human GENWAYS BULK bulk 0 €

GEN9243514171 recombinant HUMAN SERPINI1 GENWAYS 1 x 1 vial 614 €

GEN1723825985 antibody to or anti- Retinoic Acid Receptor B (RAR B/NR1B2) (RARB) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN9945914502 Interferon Alpha K (recombinant) Human GENWAYS 1 x 1 vial 914 €

GEN4311778437 Mouse antibody to or anti-Human CD62E (E-selectin), antibody GENWAYS 1 x 1 vial 568 €

GEN2255998810 sVEGF-R1 (sFLT1/D1-5 insect cells) recombinant Human GENWAYS 1 x 1 vial 729 €

GEN2941033642 Tnf Receptor Superfamily, Member 12 (TNFRSF12) (TNFRSF25) Rabbit antibody to or anti-Human Polyclonal (Extracellular Domain) antibody GENWAYS 1 x 1 vial 648 €

GEN3050408048 Transforming Growth Factor B 3 (TGFB3) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN2869812745 Goat antibody to or anti-Human IgG ( chain specificity) GENWAYS 1 x 1 vial 296 €

GEN1820883517 Solute Carrier Family 5 (sodium/glucose Cotransporter) Member 10 (SLC5A10) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2883756816 Gi Alpha 1/2 Rabbit antibody to or anti-Human Polyclonal (aa345-354) antibody GENWAYS 1 x 1 vial 602 €

GEN4786515946 Human Plasma Haptoglobin GENWAYS 1 x 1 vial 447 €

GEN7005000707 Mouse antibody to or anti-Human IgM (u chain specificity), antibody GENWAYS 1 x 1 vial 654 €

GEN4731910542 Histone Deacetylase 3 (HDAC3) Rabbit antibody to or anti-Human Polyclonal (aa2-17) antibody GENWAYS 1 x 1 vial 602 €

GEN8253375389 Cullin Homolog 2 (CUL2) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN3321579128 anti-Human IgM (Mu chain, Fab-Region) Antibody ACR 0,1 mg 311 €

GEN7899207096 Likely Ortholog Of Mouse Monocyte Macrophage 19 (MMRP19) (APIP) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN9781465198 antibody to or anti- B-2 Microglobulin (Human Urine) -biotin conjugated antibody GENWAYS 1 x 1 vial 971 €

GEN6871589056 Ig Lambda Light Chain Rabbit antibody to or anti-Human Polyclonal (N- terminus) (K22-Y) antibody GENWAYS 1 x 1 vial 602 €

GEN7274089634 antibody to or anti- Human Growth Hormone (HGH) antibody GENWAYS 1 x 1 vial 429 €

GEN4381935526 Granzyme B (granzyme 2 Cytotoxic T-lymphocyte-associated Serine Esterase 1) (GZMB) Rabbit antibody to or anti-Human Polyclonal (N- terminus) An GENWAYS 1 x 1 vial 648 €

GEN4195327065 Recombinant Human Annexin A6 GENWAYS BULK bulk 0 €

GEN6751300787 antibody to or anti- Dipeptidylpeptidase 9 (DPP9) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN8354869615 Alkaline Phosphatase labelled Affinity Purified antibody to or anti-HUMAN IgG F(ab')2 (RABBIT) (Min X MOUSE Serum proteins) GENWAYS 1 x 1 vial 463 €

GEN9184737309 Rabbit antibody to or anti-Rat IgG (H+L) Absorbed against human immunoglobulins GENWAYS 1 x 1 vial 324 €

GEN2374467309 anti-Human Lambda Light Chain Antibody ACR 0,1 mg 355 €

GEN9280644798 antibody to or anti- Immunoglobulin G (IgG) Fc Human antibody GENWAYS 1 x 1 vial 486 €

GEN2806648506 Fluorescein labelled Affinity Purified antibody to or anti-HUMAN IgA (alpha chain) (RABBIT) GENWAYS 1 x 1 vial 342 €

GEN6292798827 A2M Human GENWAYS BULK bulk 0 €

GEN6791032880 antibody to or anti- Prostaglandin E Receptor EP2 (PTGER2) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN1746890593 Goat antibody to or anti-Human IgG ( chain specificity) GENWAYS 1 x 1 vial 521 €

GEN1803578497 Adrenomedullin (1-52) Human GENWAYS BULK bulk 0 €

GEN4952523499 Tumor Necrosis Factor (ligand) Superfamily Member 13b (TNFSF13B/Baff) Rabbit antibody to or anti-Human Polyclonal (aa254-269) antibody GENWAYS 1 x 1 vial 602 €

GEN7398511265 Mouse Anti-Human Macrophage Inflammatory Protein-1a (CCL3), Antibody GENWAYS BULK bulk 0 €

GEN8954480325 Kallikrein 11 (KLK11) Rabbit antibody to or anti-Human Polyclonal (aa68-82) antibody GENWAYS 1 x 1 vial 602 €

GEN1331986248 anti-Human IgA (secretory) Antibody ACR 0,1 mg 326 €

GEN2715180610 Recombinant Human Tyrosine-Protein Kinase LYN GENWAYS BULK bulk 0 €

GEN1307400346 Fluorescein labelled Affinity Purified antibody to or anti-HUMAN (kappa chain) (GOAT) GENWAYS 1 x 1 vial 377 €

GEN9342646727 Myeloid/lymphoid Or Mixed-lineage Leukemia Translocated To 1 (MLLT1) Rabbit antibody to or anti-Human Polyclonal (aa538-553) antibody GENWAYS 1 x 1 vial 602 €

GEN4506550828 anti-Human Kappa Light Chain Antibody ACR 0,1 mg 355 €

GEN8605974677 anti-Human IgM (Fc specific) Antibody ACR 0,1 mg 442 €

GEN7592428489 anti-Human IgM (Fc-region) Antibody ACR 0,1 mg 311 €

GEN6790120871 anti-Human IgM (Fc specific) Antibody ACR 0,1 mg 442 €

GEN7958766143 anti-Human IgM (Fc-region) Antibody ACR 0,1 mg 384 €

GEN3146891007 anti-Human IgM (Fc-region) Antibody ACR 0,1 mg 442 €

GEN5271302333 anti-Human IgG (F(ab)2 specific) Antibody ACR 0,1 mg 442 €

GEN9929424133 anti-Human IgG (F(ab)2 specific) Antibody ACR 0,1 mg 311 €

GEN8289684424 Mouse Anti Human Erythropoietin, Antibody GENWAYS BULK bulk 0 €

GEN7806126117 anti-Human IgE Antibody ACR 0,1 mg 442 €

GEN3275810048 Interleukin-8 (IL-8) (72a.a) Human GENWAYS 1 x 1 vial 579 €

GEN9788170564 anti-Human IgE Antibody ACR 0,1 mg 311 €

GEN1588753503 anti-Human IgE Antibody ACR 0,1 mg 384 €

GEN1183389545 G protein-Coupled Receptor GPR2/CCR10 Rabbit antibody to or anti-Human Polyclonal (aa350-362) antibody GENWAYS 1 x 1 vial 602 €

GEN4152563206 anti-Human IgA (alpha chain) Antibody ACR 0,1 mg 311 €

GEN5131526707 Neuroendocrine-specificity protein C (RTN4) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN5338156965 Mouse IgM antibody (APC) (human adsorbed) GENWAYS 1 x 1 vial 896 €

GEN3381825770 Paired Box protein Pax-8 Isoforms 8c/8d (PAX8) Goat antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN2770831095 Rabbit antibody to or anti-Human IgG (H+L) GENWAYS 1 x 1 vial 244 €

GEN2638851896 Interleukin-16 (IL-16) Human recombinant GENWAYS 1 x 1 vial 579 €

GEN4536621096 CD41a (GP IIb) Human -biotin conjugated, antibody GENWAYS 1 x 1 vial 845 €

GEN8740786525 Mouse antibody to or anti-Human IgM (u chain specificity), antibody GENWAYS 1 x 1 vial 481 €

GEN8470272165 GH Human 20kDa GENWAYS BULK bulk 0 €

GEN9788085931 Osteocrin Human GENWAYS BULK bulk 0 €

GEN8362130002 Aurora Kinase A, Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN1940966110 Induced Myeloid Leukemia Cell Differentiation protein Mcl-1 (MCL1) Mouse antibody to or anti-Human Monoclonal (8C6D4B1) antibody GENWAYS 1 x 1 vial 602 €

GEN4626751259 Recombinant Human Fractalkine (CX3CL1) His Tag GENWAYS BULK bulk 0 €

GEN3602872348 Intraflagellar Transport 74 Homolog (Chlamydomonas) (IFT74) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN7562119145 Suppression Of Tumorigenicity 5 (ST5) Rabbit antibody to or anti-Human Polyclonal (aa1121-1137) antibody GENWAYS 1 x 1 vial 602 €

GEN5860362254 Human IgG Isotype Control GENWAYS 1 x 1 vial 287 €

GEN1939221525 Human IgM Polyclonal GENWAYS 1 x 1 vial 278 €

GEN3896029036 Mouse antibody to or anti-Human IgG2 (2 chain specificity), antibody GENWAYS 1 x 1 vial 562 €

GEN6850288029 Crm1 protein (XPO1) Rabbit antibody to or anti-Human Polyclonal (aa390-408) antibody GENWAYS 1 x 1 vial 602 €

GEN3645178713 G protein-Coupled Receptor GPR32 Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN6245855630 KGF Human GENWAYS BULK bulk 0 €

GEN7796155375 Forkhead Box O4 (FOXO4) Rabbit antibody to or anti-Human Polyclonal (aa59-73) antibody GENWAYS 1 x 1 vial 602 €

GEN5426845231 Recombinant Human Phosphodiesterase 6D cGMP-Specific Rod Delta GENWAYS BULK bulk 0 €

GEN4714807432 Attractin (ATRN) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2809096906 Prostaglandin E Receptor EP2 (PTGER2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN9209880108 C4c Human GENWAYS BULK bulk 0 €

GEN5339992668 Human Chorionic Gonadotropin B GENWAYS 1 x 1 vial 1127 €

GEN3019883458 Human Plasminogen GENWAYS 1 x 1 vial 290 €

GEN4283498368 Mouse antibody to or anti-Human Bcl-xL, antibody GENWAYS 1 x 1 vial 786 €

GEN9859710876 Mammaglobin 1 (SCGB2A2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 648 €

GEN2846590523 Recombinant Human Glutathione S-Transferase pi 1 GENWAYS BULK bulk 0 €

GEN2498503314 Optineurin (OPTN) Rabbit antibody to or anti-Human Polyclonal (aa575-591) antibody GENWAYS 1 x 1 vial 602 €

GEN2374969166 FK506 Binding protein 12-rapamycin Associated protein 1 (FRAP1) Rabbit antibody to or anti-Human Polyclonal (pSer2448) antibody GENWAYS 1 x 1 vial 602 €

GEN2583759321 A20 (Sf9) Human recombinant protein GENWAYS 1 x 1 vial 683 €

GEN2308767690 Melanoma Differentiation Associated protein-5 (MDA5) (IFIH1) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody GENWAYS 1 x 1 vial 602 €

GEN6770131207 Urokinase Mixed Human >95% GENWAYS 1 x 1 vial 591 €

GEN1242883789 Aquaporin 2 (Collecting Duct) (AQP2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN5810817360 Hemoglobin A1c Human GENWAYS 1 x 1 vial 1076 €

GEN1314364343 Mouse antibody to or anti-Human Bcl-xL, antibody GENWAYS 1 x 1 vial 498 €

GEN9852760562 Heat Shock 60kDa protein 1 (chaperonin) (HSPD1) Rabbit antibody to or anti-Human Polyclonal (aa31-50) antibody GENWAYS 1 x 1 vial 648 €

GEN5473829114 HMGB1 Human GENWAYS BULK bulk 0 €

GEN9026102221 Rabbit IgG (H/L) antibody (human/rat/mouse adsorbed) (biotin conjugated) GENWAYS 1 x 1 vial 585 €

GEN5472672731 Keratin Type I Cytoskeletal 18 (KRT18) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 648 €

GEN3671432739 Interferon Alpha/B Receptor 1 Human, antibody GENWAYS 1 x 1 vial 971 €

GEN1193939398 X-ray Repair Complementing Defective Repair In Chinese Hamster Cells 5 (XRCC5) Mouse antibody to or anti-Human Monoclonal (F3) antibody GENWAYS 1 x 1 vial 602 €

GEN3108586601 Recombinant Human Quinone Oxidoreductase-like Protein 1 GENWAYS BULK bulk 0 €

GEN8790739336 antibody to or anti- G protein-Coupled Receptor OGR1/GPR68 Human antibody GENWAYS 1 x 1 vial 1053 €

GEN4219870593 Texas Red labelled Affinity Purified antibody to or anti-HUMAN IgG F(c) (GOAT) Min X MOUSE Serum proteins GENWAYS 1 x 1 vial 342 €

GEN1374611534 UbC9 Human GENWAYS BULK bulk 0 €

GEN7543112705 Mouse antibody to or anti-Human IgG4 (4 chain specificity), antibody GENWAYS 1 x 1 vial 591 €

GEN6609451798 Human IgD 96 well plate ELISA assay GENWAYS 1 x 1 vial 439 €

GEN2817511836 Human IgA 96 well plate ELISA assay GENWAYS 1 x 1 vial 419 €

GEN4461095932 Human Cystatin C 96 well plate ELISA assay GENWAYS 1 x 1 vial 597 €

GEN5731985765 sIL-6R Human GENWAYS BULK bulk 0 €

GEN1891693655 Epidermal Growth Factor Receptor (EGFR) Rabbit antibody to or anti-Human Polyclonal (aa1166-1180) antibody GENWAYS 1 x 1 vial 602 €

GEN3561622243 DDR2 Active Human recombinant protein GENWAYS 1 x 1 vial 458 €

GEN7071754990 Zinc Finger protein 198 (ZNF198) (ZMYM2) Rabbit antibody to or anti-Human Polyclonal (aa1250-1300) antibody GENWAYS 1 x 1 vial 602 €

GEN3743547665 Niacin Receptor 2 (NIACR2) Rabbit antibody to or anti-Human Polyclonal (aa1-50) antibody GENWAYS 1 x 1 vial 602 €

GEN9254942385 Integrin, Alpha X (Antigen CD11C (P150), Alpha Poly peptide sequence) (ITGAX), Human GENWAYS 1 x 1 vial 1053 €

GEN6547970128 Human proBNP N-terminusinal GENWAYS 1 x 1 vial 810 €

GEN3347764574 Centaurin Alpha 2 (CENTA2) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN2124457689 CASP2 And RIPK1 Domain Containing Adaptor With Death Domain (CRADD) Rabbit antibody to or anti-Human Polyclonal (aa99-117) antibody GENWAYS 1 x 1 vial 602 €

GEN3112336277 anti-Mouse IgG2a Isotype Control (not for use on humans) Antibody ACR 100 Tests 804 €

GEN1446926605 anti-Mouse IgG2a Isotype Control (not for use on humans) Antibody ACR 100 Tests 529 €

GEN7000531627 anti-Mouse IgG2a Isotype Control (not for use on humans) Antibody ACR 0,5 mg 848 €

GEN2620572421 anti-Mouse IgG2a Isotype Control (not for use on humans) Antibody ACR 0,1 mg 674 €

GEN9920705024 Aminolevulinate Delta- Synthase 1 (ALAS1) Rabbit antibody to or anti-Human Polyclonal (aa480-530) antibody GENWAYS 1 x 1 vial 602 €

GEN6882093717 anti-Chimaeric human IgM anti Nitrophenyl-hapten (NP) Antibody ACR 2 ml 804 €

GEN8530168762 Human Transferrin 96 well plate ELISA assay Kit GENWAYS 1 x 1 vial 458 €

GEN9554221314 anti-Chimaeric Human IgG2 anti Nitrophenyl-hapten (NP) Antibody ACR 0,5 mg 833 €

GEN9282995881 anti-Chimaeric Human IgE anti Nitrophenyl-hapten (NP) Antibody ACR 2 ml 978 €

GEN8340753839 Recombinant Human Aldo-Keto Reductase Family 1 Member C3 GENWAYS BULK bulk 0 €

GEN5306403888 Glial Fibrillary Acidic protein (GFAP) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN4596622017 Fe65-like protein (APBB2) Rabbit antibody to or anti-Human Polyclonal (aa315-330) antibody GENWAYS 1 x 1 vial 602 €

GEN3603222536 Fibrinogen Goat antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN5334386423 Rabbit antibody to or anti-Human IgG (H+L) Absorbed against mouse immunoglobulins GENWAYS 1 x 1 vial 262 €

GEN2659182271 ATG4 Autophagy Related 4 Homolog B (ATG4B) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN6975318604 Mouse antibody to or anti-Human IgG1 (1 chain specificity), antibody GENWAYS 1 x 1 vial 481 €

GEN7902778251 Bone Morphogenetic protein 4 (BMP4) Rabbit antibody to or anti-Human Polyclonal (aa20-34) antibody GENWAYS 1 x 1 vial 602 €

GEN2143131362 Oxoeicosanoid Receptor 1 (OXER1) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN3471162012 IL-13 Human His GENWAYS BULK bulk 0 €

GEN1281669025 Goat F(ab')2 antibody to or anti-Human IgM (u chain specificity) GENWAYS 1 x 1 vial 348 €

GEN3039437258 antibody to or anti- Interleukin 8 Receptor B (CXCR2) (IL8RB) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN4844029892 Recombinant Human Interleukin-3 Yeast GENWAYS BULK bulk 0 €

GEN6508722845 anti-Human IgG2 (F(ab)2 specific) Antibody ACR 0,2 mg 790 €

GEN6555945865 PKC-g Human GENWAYS BULK bulk 0 €

GEN1826316524 Human proBNP, N-terminusinal GENWAYS 1 x 1 vial 804 €

GEN9323485202 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 100 Tests 804 €

GEN8576960089 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 0,1 mg 529 €

GEN6388092574 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 0,5 mg 848 €

GEN6271223031 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 0,1 mg 674 €

GEN6599318507 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 100 Tests 630 €

GEN1935098396 Mouse antibody to or anti-Human CD15, antibody GENWAYS 1 x 1 vial 447 €

GEN1767873738 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 0,1 mg 674 €

GEN2191159151 anti-Mouse IgG1 Isotype Control (not for use on humans) Antibody ACR 1 mg 1225 €

GEN8998387711 Atp-Binding Cassette Subfamily B (Mdr/Tap) Member 3 (Abcb3) (TAP2) Rabbit antibody to or anti-Human Polyclonal (aa689-703) antibody GENWAYS 1 x 1 vial 602 €

GEN1319858913 antibody to or anti- 5-HT7 Receptor (HTR7) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN8367559158 Goat antibody to or anti-Human kappa ( chain specificity) Absorbed against mouse Igs GENWAYS 1 x 1 vial 521 €

GEN9917937776 Tyk2 Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN3918234699 CD30 (Ki-1) Human, antibody GENWAYS 1 x 1 vial 729 €

GEN7320074273 GDNF Human GENWAYS BULK bulk 0 €

GEN5807831340 G protein-Coupled Receptor GPR27/SREB1 Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN1574962925 Secretin Human GENWAYS 1 x 1 vial 290 €

GEN4172701259 Interferon-Induced Double-Stranded RNA-Activated protein Kinase (PRKR) (EIF2AK2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) Antib GENWAYS 1 x 1 vial 602 €

GEN8871473348 antibody to or anti- Integrin Alpha 4 (antigen CD49D Alpha 4 Subunit Of VLA-4 Receptor) (ITGA4) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN1389413662 Mouse antibody to or anti-Human CD107a (LAMP-1), antibody GENWAYS 1 x 1 vial 516 €

GEN6107205997 anti-Human IgG4 Antibody ACR 0,2 mg 688 €

GEN7756855921 Mouse Anti Human Ig Lambda Light Chain, Antibody GENWAYS BULK bulk 0 €

GEN6339403783 anti-Human IgG4 Antibody ACR 0,2 mg 1123 €

GEN4500994027 anti-Human IgG4 Antibody ACR 1 ml 500 €

GEN5759257755 Procalcitonin Human GENWAYS BULK bulk 0 €

GEN4963157108 Serine/Threonine protein Kinase CHK1 (CHEK1) Rabbit antibody to or anti-Human Polyclonal (Ser280) antibody GENWAYS 1 x 1 vial 602 €

GEN5961358276 Vascular Endothelial Growth Factor Receptor 3 (FLT4) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN8734722000 SMAD Mothers Against DPP Homolog 9 (SMAD9) Goat antibody to or anti-Human Polyclonal (Internal) antibody GENWAYS 1 x 1 vial 648 €

GEN8966168226 Mouse antibody to or anti-Human IgM (u chain specificity), antibody GENWAYS 1 x 1 vial 521 €

GEN5320056124 Recombinant Human Capping Protein Gelsolin-Like GENWAYS BULK bulk 0 €

GEN2657535025 CD95 Human GENWAYS BULK bulk 0 €

GEN5854615985 Human Azurocidin GENWAYS 1 x 1 vial 498 €

GEN5558824018 VEGFR-1 D3 Human GENWAYS BULK bulk 0 €

GEN4015052138 Recombinant Human NAD(P)H Dehydrogenase Quinone 1 GENWAYS BULK bulk 0 €

GEN7653267591 Toll-like Receptor 4 (TLR4) Mouse antibody to or anti-Human Monoclonal (aa100-200) (76B357.1) antibody GENWAYS 1 x 1 vial 602 €

GEN4171660954 CD101 Human -FITC conjugated, antibody GENWAYS 1 x 1 vial 1041 €

GEN7004884129 HK3 Human GENWAYS BULK bulk 0 €

GEN7133788965 Apeced protein (AIRE) Goat antibody to or anti-Human Polyclonal (Internal) antibody GENWAYS 1 x 1 vial 602 €

GEN5176652658 Mouse antibody to or anti-Human IgG4 (4 chain specificity), antibody GENWAYS 1 x 1 vial 498 €

GEN5880814748 Recombinant Human Proliferating Cell Antigen GENWAYS BULK bulk 0 €

GEN8528864305 Human Follicular Gonadotropin Releasing peptide sequence (Hf-GRP) GENWAYS 1 x 1 vial 313 €

GEN9866919782 CD10 Human, antibody GENWAYS 1 x 1 vial 1641 €

GEN8573113675 B2GP1 Human GENWAYS BULK bulk 0 €

GEN3901004273 recombinant HUMAN INTERLEUKIN-22 GENWAYS 1 x 1 vial 614 €

GEN6790851021 Human B-2 gp I Apo H GENWAYS 1 x 1 vial 1122 €

GEN9551653089 Rhodamine labelled Affinity Purified antibody to or anti-HUMAN IgG (gamma chain) (RABBIT) GENWAYS 1 x 1 vial 381 €

GEN5379708779 Galanin-like peptide sequence Human GENWAYS 1 x 1 vial 417 €

GEN3239413890 Rabbit antibody to or anti-Mouse IgG (H+L) Absorbed against human immunoglobulins GENWAYS 1 x 1 vial 365 €

GEN4514254808 CD25 (IL2-R alpha TAC) Human, antibody GENWAYS 1 x 1 vial 729 €

GEN2537189944 Kell Blood Group Precursor (McLeod Phenotype) (Xk) Rabbit antibody to or anti-Human Polyclonal (aa409-425) antibody GENWAYS 1 x 1 vial 602 €

GEN8404064881 CD79A Antigen (immunoglobulin-associated Alpha) (CD79A) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 648 €

GEN1382088687 Mouse antibody to or anti-Human CD45 (LCA), antibody GENWAYS 1 x 1 vial 447 €

GEN4133025840 PTH 7-34 Human GENWAYS BULK bulk 0 €

GEN5872727648 Tie2, Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN3868975854 Serine/Threonine protein Kinase ULK1 Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2578981825 anti-Human IgE Antibody ACR 0,5 mg 1210 €

GEN7024221070 anti-Human IgE Antibody ACR 1 mg 1370 €

GEN5253276937 anti-Human IgE Antibody ACR 0,2 mg 703 €

GEN8386338527 anti-Human IgE Antibody ACR 0,1 mg 543 €

GEN5552579834 anti-Human IgE Antibody ACR 0,5 mg 833 €

GEN1334109109 Recombinant Human Superoxide Dismutase-1 GENWAYS BULK bulk 0 €

GEN3189405769 Human Haptoglobin 96 well plate ELISA assay Kit GENWAYS 1 x 1 vial 463 €

GEN9656073038 Recombinant Human Peptidylprolyl Isomerase (Cyclophilin)-Like 1 GENWAYS BULK bulk 0 €

GEN5578732988 Complement Component 5a Receptor 1/ CD88 (C5AR1) Mouse antibody to or anti-Human Monoclonal (S5/1) antibody GENWAYS 1 x 1 vial 648 €

GEN5611526032 Mouse antibody to or anti-Human IgD ( chain specificity), antibody GENWAYS 1 x 1 vial 377 €

GEN2999249258 IP-10 Human GENWAYS BULK bulk 0 €

GEN3477132836 RAD52 Homolog (RAD52) Mouse antibody to or anti-Human Monoclonal (5H9) antibody GENWAYS 1 x 1 vial 602 €

GEN2689565249 G protein-Coupled Receptor 182 (GPR182) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN4937714331 Human Apolipoprotein B GENWAYS 1 x 1 vial 285 €

GEN9445795188 Affinity Purified antibody to or anti-HUMAN IgM (mu chain) (GOAT) GENWAYS 1 x 1 vial 276 €

GEN7682642931 FST Human GENWAYS BULK bulk 0 €

GEN5196311528 Tuberous Sclerosis 2 (TSC2) Rabbit antibody to or anti-Human Polyclonal (pThr1462) antibody GENWAYS 1 x 1 vial 602 €

GEN5099498801 Aha1, Active Human recombinant protein GENWAYS 1 x 1 vial 717 €

GEN3554815288 anti-Respiratory Syncytial Virus / RSV bovine and human strains (Nucleoprotein) Antibody ACR 1 mg 833 €

GEN4885500922 anti-Respiratory Syncytial Virus / RSV bovine and human strains (Fusion protein) Antibody ACR 1 mg 833 €

GEN5893046750 Rat antibody to or anti-Human IL-6, antibody GENWAYS 1 x 1 vial 631 €

GEN7195280401 L-Sel Human GENWAYS BULK bulk 0 €

GEN9048087504 antibody to or anti-HUMAN SERUM ALBUMIN antibody GENWAYS 1 x 1 vial 667 €

GEN4014572461 UbcH7 (E. coli) Active Human recombinant protein GENWAYS 1 x 1 vial 509 €

GEN1516113096 Adenosine A2a Receptor (ADORA2A) Mouse antibody to or anti-Human Monoclonal (3rd Intracellular Domain) antibody GENWAYS 1 x 1 vial 648 €

GEN3533687967 Nuclear Receptor Nak1 (NR4A1) Rabbit antibody to or anti-Human Polyclonal (aa251-266) antibody GENWAYS 1 x 1 vial 602 €

GEN9984970440 antibody to or anti- Plasminogen Human antibody GENWAYS 1 x 1 vial 440 €

GEN2306052427 Gastrin Releasing Peptide Human GENWAYS BULK bulk 0 €

GEN2171422816 Recombinant Human Mitogen-Activated Protein Kinase 1 His Tag GENWAYS BULK bulk 0 €

GEN6246798830 CXC Chemokine Receptor 4 (CXCR4) Mouse antibody to or anti-Human Monoclonal (12G5) antibody GENWAYS 1 x 1 vial 602 €

GEN8211515826 biotin conjugated labelled Affinity Purified antibody to or anti-HUMAN IgG (H&L) (GOAT) GENWAYS 1 x 1 vial 320 €

GEN1582913886 Human Tissue Lysate (Normal) Human Prostate GENWAYS 1 x 1 vial 602 €

GEN7202462412 ATP-Binding Cassette Sub-Family B (Mdr/Tap) Member 7 (Abcb7) Rabbit antibody to or anti-Human Polyclonal (aa733-747) antibody GENWAYS 1 x 1 vial 602 €

GEN7819205848 Mouse F(ab\')2 antibody to or anti-Human CD20, antibody GENWAYS 1 x 1 vial 665 €

GEN5300433854 TnT Human GENWAYS BULK bulk 0 €

GEN3563899322 Angiotensin I Human GENWAYS 1 x 1 vial 198 €

GEN5941176680 Human Myeloperoxidase GENWAYS 1 x 1 vial 250 €

GEN1622517815 Serine Palmitoyltransferase Long Chain Base Subunit 2 (SPTLC2) Rabbit antibody to or anti-Human Polyclonal (aa548-562) antibody GENWAYS 1 x 1 vial 602 €

GEN9887230002 v-Akt Murine Thymoma Viral Oncogene Homolog 1 (AKT1) Rabbit antibody to or anti-Human Polyclonal (pSer473) antibody GENWAYS 1 x 1 vial 602 €

GEN8758139353 Mouse antibody to or anti-Human CD3 GENWAYS 1 x 1 vial 591 €

GEN9079558977 GHRF (1-44) Human GENWAYS BULK bulk 0 €

GEN6709489183 NGAL Human GENWAYS BULK bulk 0 €

GEN5911359557 Myosin Regulatory Light Chain 2 Smooth Muscle Isoform (MYL9) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2928308820 B7-H1 protein (CD274) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody GENWAYS 1 x 1 vial 602 €

GEN3671094757 Interleukin-15 (IL-15) Human GENWAYS 1 x 1 vial 10616 €

GEN7901459187 IRF-3 Human GENWAYS BULK bulk 0 €

GEN5391294990 Antigen P97 (MFI2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2145726906 Alkaline Phosphatase labelled Affinity Purified antibody to or anti-Mouse IgG F(ab')2 [Rabbit] Minimum Cross Reactivity to Human Serum Protei GENWAYS 1 x 1 vial 463 €

GEN3304084138 Calcitonin human, antibody GENWAYS 1 x 1 vial 579 €

GEN7277327417 NT-proBNP human, antibody GENWAYS 1 x 1 vial 1053 €

GEN7669432230 I-kappa-B-interacting Ras-like protein 1 (KBRAS1) (NKIRAS1) Mouse antibody to or anti-Human Monoclonal (aa96-113) (184C278) antibody GENWAYS 1 x 1 vial 602 €

GEN7577949722 antibody to or anti- G protein-Coupled Receptor GPR152/PGR5 Human antibody GENWAYS 1 x 1 vial 1053 €

GEN4739051443 Prolactin Human GENWAYS BULK bulk 0 €

GEN8956523398 Mouse antibody to or anti-Human IgG2 (2 chain specificity), antibody GENWAYS 1 x 1 vial 562 €

GEN2176264182 Mouse antibody to or anti-Human IgG1 (1 chain specificity), antibody (HRP) GENWAYS 1 x 1 vial 481 €

GEN5531197105 Ephrin-b3 (EFNB3) Rabbit antibody to or anti-Human Polyclonal (aa135-341) antibody GENWAYS 1 x 1 vial 648 €

GEN4779339349 Affinity Purified antibody to or anti-GOAT IgG F(ab')2 (RABBIT) (Min X Human Serum proteins) GENWAYS 1 x 1 vial 320 €

GEN7635310589 N-Acylneuraminate-9-Phosphatase (NANP) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN2501588195 Inhibitor Of Growth 1 Family Member 1 (ING1) Goat antibody to or anti-Human Polyclonal (aa285-296) antibody GENWAYS 1 x 1 vial 648 €

GEN9299195573 Clusterin (Apolipoprotein J) Human, antibody GENWAYS 1 x 1 vial 1526 €

GEN6275219566 Recombinant Human Thymus Expressed Chemokine (CCL25) GENWAYS BULK bulk 0 €

GEN2779437916 Human Trypsin GENWAYS 1 x 1 vial 532 €

GEN4488257615 Recombinant Human Thymidylate Synthetase GENWAYS BULK bulk 0 €

GEN9361988840 GDF-5 Human GENWAYS BULK bulk 0 €

GEN4808644630 Clusterin (CLU) Mouse antibody to or anti-Human Monoclonal (Hs-3) antibody GENWAYS 1 x 1 vial 602 €

GEN4931793806 Lifeguard (KIAA0950) (FAIM2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN1831730421 Goat F(ab')2 antibody to or anti-Human kappa ( chain specificity) Absorbed against mouse Igs GENWAYS 1 x 1 vial 493 €

GEN5250814725 PACAP (6-27) Human Ovine Rat GENWAYS BULK bulk 0 €

GEN6151897799 antibody to or anti- Leucocyte Elastase Human antibody GENWAYS 1 x 1 vial 971 €

GEN1610005659 Recombinant Human Vacuolar Protein Sorting 28 GENWAYS BULK bulk 0 €

GEN7533607638 Recombinant Human Histamine N-Methyltransferase GENWAYS BULK bulk 0 €

GEN8659039510 Interleukin 1 Receptor Type II (IL1R2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN5452965158 Collagen Type VI Alpha 1 (COL6A1) Rabbit antibody to or anti-Human Polyclonal (biotin conjugated) antibody GENWAYS 1 x 1 vial 602 €

GEN4155128538 Recombinant Human Solute Carrier Family 4 Sodium Bicarbonate Cotransporter Member 4 GENWAYS BULK bulk 0 €

GEN1658901841 Texas Red labelled Affinity Purified antibody to or anti-HUMAN IgG (H&L) (GOAT) (Min X MOUSE Serum proteins) GENWAYS 1 x 1 vial 331 €

GEN6038252214 Recombinant Human Polyadenylate-Binding Protein-Interacting Protein 2 GENWAYS BULK bulk 0 €

GEN4312642794 CDC16 Cell Division Cycle 16 Homolog (CDC16) Rabbit antibody to or anti-Human Polyclonal (pThr580) antibody GENWAYS 1 x 1 vial 602 €

GEN3310526734 antibody to or anti- G protein-Coupled Receptor L1/G10D (ADMR) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN8541586612 PTH 1-34 Human GENWAYS BULK bulk 0 €

GEN4011606206 Mouse antibody to or anti-Human CD14, antibody GENWAYS 1 x 1 vial 573 €

GEN7279606408 MAP3K14(NIK), Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN9296179046 TPO Human GENWAYS BULK bulk 0 €

GEN5175796630 antibody to or anti- FMS-Related Tyrosine Kinase 3 (FLT3) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN2948105741 Peroxidase labelled Affinity Purified antibody to or anti-HUMAN IgG (H&L) (GOAT) GENWAYS 1 x 1 vial 331 €

GEN1353319197 Mucin 6 Human, antibody GENWAYS 1 x 1 vial 1041 €

GEN9075840003 Cullin 9 (CUL9/PARC) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN1404713304 B-site APP-Cleaving Enzyme 1 (BACE1) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN8011396249 GHRP-2 Human GENWAYS BULK bulk 0 €

GEN1972522768 Human IP-10 (CXCL10) GENWAYS 1 x 1 vial 400 €

GEN6201320102 Karyopherin Alpha 4 (importin Alpha 3) (KPNA4) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN4693537927 Mouse antibody to or anti-Human CD8 GENWAYS 1 x 1 vial 591 €

GEN7062472956 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma GENWAYS BULK bulk 0 €

GEN2973032228 TGF-b 3 (207 a.a.) Human GENWAYS BULK bulk 0 €

GEN8168438752 Human Myeloma IgA1 Lambda GENWAYS 1 x 1 vial 400 €

GEN5364608174 Frizzled-9 (FZD9) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN5515909073 IL-11 Human GENWAYS BULK bulk 0 €

GEN2758593304 Human HDL 3 Subfraction GENWAYS 1 x 1 vial 360 €

GEN8189883325 Death-Associated protein Kinase 3 (DAPK3) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody GENWAYS 1 x 1 vial 602 €

GEN9452103726 I-309 Human GENWAYS BULK bulk 0 €

GEN4211188567 Human Transforming Growth Factor-Beta 1 GENWAYS BULK bulk 0 €

GEN4047204445 Recombinant Human Cyclophilin-E GENWAYS BULK bulk 0 €

GEN2484822365 Cyclin-Dependent Kinase 7 (CDK7) Rabbit antibody to or anti-Human Polyclonal (pSer167 pThr170) antibody GENWAYS 1 x 1 vial 602 €

GEN9974764604 Mouse antibody to or anti-Human CD4 GENWAYS 1 x 1 vial 678 €

GEN8963894038 BAI1-associated protein 3 (BAIAP3) Rabbit antibody to or anti-Human Polyclonal (aa1171-1187) antibody GENWAYS 1 x 1 vial 602 €

GEN1497378916 Affinity Purified antibody to or anti-HUMAN IgG (gamma chain) (GOAT) GENWAYS 1 x 1 vial 353 €

GEN3866553305 Recombinant Human Tyr-3/Trp-5 Monooxygenase Activation Protein Gamma His Tag GENWAYS BULK bulk 0 €

GEN1849310990 Recombinant Human Insulin Yeast GENWAYS BULK bulk 0 €

GEN7414679311 Group III Secreted Phospholipase A2 (GIII-SPLA2) (PLA2G3) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN8317401082 antibody to or anti- Parathyroid Hormone (PTH) Human antibody GENWAYS 1 x 1 vial 452 €

GEN2412558305 SGRF protein Interleukin 23 P19 Subunit (IL23A) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN3523948760 recombinant HUMAN ADIPONECTIN GENWAYS 1 x 1 vial 614 €

GEN5365327202 G protein-Coupled Receptor GPR43 (FFAR2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN9060429824 Estrogen Receptor Alpha (ER Alpha/NR3A1) (ESR1) Rabbit antibody to or anti-Human Polyclonal (C- terminus) (S21-V) antibody GENWAYS 1 x 1 vial 648 €

GEN5946138885 Myo-w/o H Human GENWAYS BULK bulk 0 €

GEN4591369119 Fluorescein labelled Affinity Purified antibody to or anti-HUMAN IgG F(c) (GOAT) Min X MOUSE Serum proteins GENWAYS 1 x 1 vial 342 €

GEN7547934956 Phosphodiesterase 1C (PDE1C) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN3534675086 Histone H4 Rabbit antibody to or anti-Human Polyclonal (aa15-30) antibody GENWAYS 1 x 1 vial 602 €

GEN5085395011 TOP1 Human GENWAYS BULK bulk 0 €

GEN9481154626 Mouse antibody to or anti-Human IFN-, antibody GENWAYS 1 x 1 vial 532 €

GEN8833490810 STAT Induced STAT Inhibitor-2 (SOCS2) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 648 €

GEN9573747455 Desmin Human GENWAYS BULK bulk 0 €

GEN6092752235 TNF Receptor-associated Factor 3 (TRAF3) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN8538399818 antibody to or anti-Human PARK-7 (Rabbit) antibody GENWAYS 1 x 1 vial 667 €

GEN6617183981 antibody to or anti- ATP-Binding Cassette Sub-Family B (Mdr/Tap) Member 1 (Abcb1) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN1294846020 IRF-1 Human GENWAYS BULK bulk 0 €

GEN2162481079 Goat antibody to or anti-Rabbit IgM+IgG (H+L chain specificity) Cross absorbed against human immunoglobulins GENWAYS 1 x 1 vial 255 €

GEN3191248652 Recombinant Human Cystatin C GENWAYS BULK bulk 0 €

GEN7085538202 Adipophilin (ADFP) Mouse antibody to or anti-Human Monoclonal (aa5-27) (FITC conjugated) antibody GENWAYS 1 x 1 vial 648 €

GEN3983910846 Lipase Human >95% GENWAYS 1 x 1 vial 740 €

GEN7623022291 Cullin-associated And Neddylation-dissociated 2 (CAND2) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody GENWAYS 1 x 1 vial 648 €

GEN9781001367 PKC iota/lambda, Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN2964408890 Human IgE 96 well plate ELISA assay Kit GENWAYS 1 x 1 vial 414 €

GEN5564980012 antibody to or anti- Prostaglandin F2-alpha receptor antibody to or anti-Human antibody GENWAYS 1 x 1 vial 602 €

GEN2875539548 Recombinant Human Peroxiredoxin-5 GENWAYS BULK bulk 0 €

GEN7783698222 TRKC, Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN7744637441 Fibroblast Growth Factor Receptor 1 (FGFR1) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody GENWAYS 1 x 1 vial 602 €

GEN2950167774 Recombinant Human Germinal Center-Associated Nuclear Protein GENWAYS BULK bulk 0 €

GEN3444265821 Recombinant Human B-Cell Maturation Antigen GENWAYS BULK bulk 0 €

GEN3606737073 Goat F(ab')2 antibody to or anti-Human lambda (chain specificity) Absorbed against mouse Igs GENWAYS 1 x 1 vial 493 €

GEN2515716020 biotin conjugated labelled Affinity Purified antibody to or anti-Mouse IgG F(ab)2 [Rabbit] Minimum Cross Reactivity to Human Serum proteins GENWAYS 1 x 1 vial 425 €

GEN4273324627 EGF Human GENWAYS BULK bulk 0 €

GEN9605084406 antibody to or anti- IkBa (human) antibody GENWAYS 1 x 1 vial 775 €

GEN3614216003 antibody to or anti- Dipeptidylpeptidase 8 (DPP8) Human antibody GENWAYS 1 x 1 vial 1053 €

GEN6741494021 Tumor Necrosis Factor Receptor Superfamily Member 13B (TNFRSF13B/TACI) Rabbit antibody to or anti-Human Polyclonal (aa116-132) antibody GENWAYS 1 x 1 vial 602 €

GEN1886080167 anti-Human IgG3 (Hinge Region) Antibody ACR 0,1 mg 514 €

GEN8344607824 anti-Human IgG3 (Hinge Region) Antibody ACR 0,5 mg 369 €

GEN6516178959 anti-Human IgG3 (Hinge Region) Antibody ACR 1 ml 514 €

GEN8787559676 Cadherin-E Human GENWAYS BULK bulk 0 €

GEN4617979783 anti-Human IgG3 (Hinge Region) Antibody ACR 0,5 mg 500 €

GEN3340644311 anti-Human IgG3 (Hinge Region) Antibody ACR 0,5 mg 442 €

GEN4545401671 Flt3, Active Human recombinant protein GENWAYS 1 x 1 vial 527 €

GEN8919234267 anti-Human IgG3 (Hinge Region) Antibody ACR 1 ml 427 €

GEN9134069101 B2M Human GENWAYS BULK bulk 0 €

GEN5176759910 Transmembrane protein 5 (TMEM5) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €

GEN1818766208 Fluorescein labelled Affinity Purified antibody to or anti-HUMAN IgM (mu chain) (GOAT) GENWAYS 1 x 1 vial 304 €

GEN9434993104 Membrane Metallo-Endopeptidase (MME/Neprilysin)/ (CD10) Rabbit antibody to or anti-Human Polyclonal (aa52-252) antibody GENWAYS 1 x 1 vial 648 €

GEN3809855804 anti-Human IgM Antibody ACR 0,2 mg 630 €

GEN6655765522 anti-Human IgM Antibody ACR 0,1 mg 674 €

GEN8639678258 anti-Human IgG2 (F(ab)2 specific) Antibody ACR 0,2 mg 659 €

GEN8088947335 anti-Human IgG2 (F(ab)2 specific) Antibody ACR 0,2 mg 1138 €

GEN4348877017 anti-Human Lambda Light Chain Antibody ACR 100 Tests 746 €

GEN9379647384 anti-Human Lambda Light Chain Antibody ACR 0,2 mg 674 €

GEN2077251915 anti-Human Lambda Light Chain Antibody ACR 0,1 mg 616 €

GEN3897638961 anti-Human IgG1 (Fc specific) Antibody ACR 0,2 mg 790 €

GEN9669782785 anti-Human IgA (Secretory component) Antibody ACR 0,2 mg 645 €

GEN7242213425 Guanine Nucleotide-binding protein G(S) Alpha Subunit (GNAS) Rabbit antibody to or anti-Human Polyclonal (aa385-394) antibody GENWAYS 1 x 1 vial 602 €

GEN3443261070 Acyl-coa Dehydrogenase Medium-chain specificity (ACADM) Rabbit antibody to or anti-Human Polyclonal antibody GENWAYS 1 x 1 vial 602 €