Name :Photobacterium fischerii Luciferase protein (partially pure), active
Price :333 €
Quantity :10 mg
Supplier :ADI
Name :Recombinant (E. coli) purified Firefly Luciferase protein, active
Price :326 €
Quantity :250 μg
Name :Rabbit Anti-Luciferase (Photobacterium fischerii) IgG-HRP Conjugate
Price :449 €
Quantity :500 μL
Name :Rabbit Anti-Luciferase (Photobacterium fischerii) IgG-FITC Conjugate
Name :Photobacterium fischerii Luciferase protein (partially pure) WB +ve control
Quantity :100 μL
Name :Rabbit Anti-Luciferase (Photobacterium fischerii) IgG-Biotin Conjugate
Name :Rabbit Anti-Luciferase (Photobacterium fischerii) IgG
Price :478 €
Name :Goat Anti-Luciferase (Fire fly) IgG-HRP Conjugate
Price :405 €
Name :Recombinant purified Firefly Luciferase protein WB +ve control
Name :Goat Anti-Luciferase (Fire fly) IgG-Biotin Conjugate
Name :Goat Anti-Luciferase (Fire fly) IgG
Name :Lactoferrin Apo, Bovine milk (95%)
Quantity :1 mg
Name :Lactoferrin, Bovine milk (95%)
Name :Recombinant Mouse Lactoferrin (>95%, low endotoxin, human cells, his-tag)
Quantity :10 μg
Name :Recombinant Human Lactoferrin (>95%, low endotoxin, human cells, his-tag)
Name :Lactoferrin, Human milk (>95% pure; iron saturated)
Name :Human recombinant (>97%) holo lactoferrin (For cell culture, low endotoxin, >95%, animal free)
Price :260 €
Quantity :100 mg
Name :Lactoferrin, Apo, Human milk (>98% pure)
Quantity :100 μg
Name :Lactoferrin, Human Neutrophil
Quantity :50 μg
Name :Mouse monoclonal Anti-rat/mouse lactoferrin IgG
Price :565 €
Name :Mouse monoclonal Anti-human lactoferrin
Name :Goat Anti-bovine lactoferrin IgG-HRP conjugate
Price :521 €
Quantity :0,5 mL
Name :Purified bovine Lactoferrin protein control for Western
Name :Goat Anti-bovine lactoferrin IgG-biotin conjugate
Name :Goat Anti-bovine lactoferrin IgG, aff pure
Name :Rabbit Anti-human lactoferrin
Name :Goat Anti-human lactoferrin IgG-HRP Conjugate
Name :Goat Anti-human lactoferrin IgG, aff pure
Name :Rabbit Anti-Human novel liver specific OAT (LST-1)
Price :536 €
Name :Human novel liver specific OAT (LST-1) Control/blocking peptide #1
Price :188 €
Name :Rabbit Anti-Human novel liver specific OAT (LST-1/OATP2/OATP-C) IgG #1, aff pure
Name :DELFNELLNSVDVNGENILEESQ, P. falciparum Liver-Stage Antigen 3-NRI (LSA3-NRI) peptide
Name :LEESQVNDDIFNSLVKSVQQEQQHNV, P. falciparum Liver-Stage Antigen 3-NRII, LSA3-NRII (81-106) peptide
Name :Recombinant (E.coli) purified Lumpy skin disease virus (LSDV) protein (>95%; 6X His-tag)
Name :Rabbit Anti-Lumpy skin disease virus (LSDV) antiserum
Name :Bovine Lumpy skin disease virus (LSDV) control for western blot
Name :Lipoxidase (200000 U/mg)
Price :913 €
Quantity :5 G
Name :Lipoxidase (100000 U/mg)
Price :623 €
Name :Rabbit Anti-Lipopolysaccharides (LPS) from E. coli (K-235) antiserum
Name :Goat Anti-Lipopolysaccharides (LPS) from E. coli (O:157) antiserum
Name :Monoclonal Anti-Lipopolysaccharides (LPS) from E. coli (O:111 B4 J5) ascites
Name :Sheep Anti-Lipopolysaccharides (LPS) from E. coli (strain J5) antiserum
Name :Lipopolysaccharides (LPS) from B. pertussis purified
Name :Monoclonal Anti-B. pertussis Lipopolysaccharide (LPS) IgG
Name :Lipopolysaccharides (LPS) from E. coli (strain O55:B5) gel purified
Name :Lipopolysaccharides (LPS) from E. coli (strain O26:B6) gel purified
Name :Lipopolysaccharides (LPS) from E. coli (strain 0157:H7) purified
Name :Lipopolysaccharides (LPS) from Salmonella enterica, purified
Name :Lipopolysaccharides (LPS) from P. aeruginosa, purified
Name :Lipopolysaccharides (LPS) from E. coli (strain K-235) purified
Name :Lipopolysaccharides (LPS) from E. coli (strain 0111:B4), cell culture grade
Name :Mouse Lipin-3 Control/blocking peptide control/blocking peptide #1
Name :Rabbit Anti-Mouse Lipin-3 IgG #1, Aff. Pure
Name :Mouse Lipin-2 Control/blocking peptide control/blocking peptide #1
Name :Rabbit Anti-Mouse Lipin-2 IgG #1, Aff. Pure
Name :Mouse Lipin-1 Control/blocking peptide control/blocking peptide #1
Name :Rabbit Anti-Mouse Lipin-1
Name :Low NSB Sample Diluent for ELISA Kit, ready to use
Price :775 €
Quantity :500 mL
Name :Lectin binding native protein (negative control for all lectins)
Quantity :1 mL
Name :Low range multi-color protein markers (6.5-45 kDa) for Western
Quantity :250 μL
Name :Rabbit Anti-Human Livin antiserum
Name :Human Livin Control/blocking peptide
Name :Recombinant (E. coli, His-tag, >95%) human Livin-beta (Beta/ML-IAP) protein WB + control
Name :Rabbit Anti-Human Livin
Name :Lipoproteins, Very Low Density, Human Plasma
Name :Lipoproteins, Low Density, Human Plasma
Name :Lipoproteins, Intermediate Density, Human Plasma
Name :Lipoproteins, High Density, Human Plasma
Name :Lipoprotein a, [Lp(a)], Human Plasma
Name :Recombinant (E. coli) Leptospira LipL32 protein (19-253 aa; >95%, 6x His-tag)
Name :Rabbit Anti-Leptospira LipL32 protein antiserum
Name :Recombinant (E. coli) Purified Leptospira LipL32 protein control for western blot
Name :Rabbit Anti-Human Leuteinizing Hormone releasing hormone (LHRH) Antiserum #1
Name :Human Leuteinizing Hormone releasing hormone (LHRH) Control/blocking peptide #1
Name :Rabbit Anti-Human Leuteinizing Hormone releasing hormone (LHRH) IgG #1, aff pure
Name :Monoclonal anti-human Lutenizing Hormone Beta (LH-Beta), IgG clone 2 aff pure
Name :Monoclonal Anti human Lutenizing Hormone Beta (LH-Beta) IgG, clone 1 aff pure
Name :Monoclonal Anti-Human Luteinizing Hormone (LH), alpha chain IgG, aff pure
Name :Goat Anti-Human Lutenizing Hormone Alpha (LH-Alpha) IgG aff pure
Name :Monoclonal anti-human Lutenizing Hormone Alpha (LH-Alpha) IgG, clone 2 aff pure
Name :Monoclonal Anti-human Lutenizing Hormone (LH- Alpha) IgG, clone 1 aff pure
Name :Mouse Monoclonal Anti-Human Luteinizing Hormone (LH), alpha chain IgG, aff pure
Name :Mouse Monoclonal Anti-Human Luteinizing Hormone (LH), Beta chain IgG #2 (detection), aff pure
Name :Mouse Monoclonal Anti-Human Luteinizing Hormone (LH), Beta chain IgG #1 (capture), aff pure
Name :Fucose-Bovine serum albumin conjugate (Fucose-BSA) for fucose binding proteins and lectins
Price :231 €
Name :Lethal factor Protease Substrate 3, AMC derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa)
Name :Lethal factor Protease Substrate 2, pNA derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa)
Name :Lethal factor Protease Substrate 1, Internally quenched Coumarin peptide substrate for monitoring LF protease activity (19aa)
Quantity :500 μg
Name :Lethal factor protease Inhibitor-1, Cell permeable, 14aa MEK2 analog, competitive inhibitor of LF
Name :G. Pig anti-B. Anthracis Lethal factor (LF) recombinant protein antiserum
Name :Goat Anti-lethal factor (B Anthracis) IgG-biotinylated
Name :Goat Anti-lethal factor (B Anthracis) IgG
Name :Purified Recombinant Anthrax Lethal Factor protein
Price :768 €
Name :Rabbit Anti-B. Anthracis Lethal factor (LF) recombinaant protein antiserum
Name :Purified Recombinant Anthrax lethal factor (LF) protein control for WB
Name :Rabbit Anti-B. Anthracis Lethal factor (LF) (C-terminal peptide) IgG#3
Name :Monoclonal Anti-Anthrax Lethal factor (LF) protein IgG biotinylated
Quantity :50
Name :Monoclonal Anti-Anthrax Lethal factor antigen IgG #2, aff pure
Name :Monoclonal Anti-Anthrax Lethal factor antigen IgG #1, aff pure
Name :Chicken Recombinant (E.Coli) Purified Leptin binding domain
Name :Human Recombinant (E.Coli) Purified Leptin binding domain
Name :Rabbit Anti-Human Recombinant Purified Leptin binding domain antiserum
Name :Monoclonal Anti-Human Leptin Protein
Name :Monoclonal Anti-Human Leptin Protein IgG-Biotinylated
Name :Ovine Recombinant (E.Coli) Purified Leptin Quadruple mutant mutant Antagonist Protein
Name :Ovine Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein
Name :Rat Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein
Name :Mouse Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein
Name :Human Recombinant (E.Coli) Purified Leptin Quadruple mutant Antagonist Protein
Name :Human Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein
Name :Rabbit Recombinant (E.Coli) Purified Leptin Protein
Name :Dog Recombinant (E.Coli) Purified Leptin Protein
Name :Chicken Recombinant (E.Coli) Purified Leptin Protein
Name :Horse Recombinant (E.Coli) Purified Leptin Protein
Name :Porcine Recombinant (E.Coli) Purified Leptin Protein
Name :Bovine Recombinant (E.Coli) Purified Leptin Protein
Name :Monoclonal Anti-Human Leptin Protein # 5
Name :Ovine Recombinant (E.Coli) Purified Leptin Protein
Name :Rat Recombinant (E.Coli) Purified Leptin Protein
Price :1058 €
Quantity :5 mg
Name :Monoclonal Anti-Human Leptin Protein antibody # 3, ascites
Name :Rabbit Anti-Human Recomb. Leptin Protein antiserum # 2
Name :Human Recombinant (E.Coli) Purified Leptin Protein
Price :1783 €
Name :Human Leptin protein Western blot +ve control # 2
Name :Rabbit Anti-Mouse Recomb. Leptin Protein antiserum # 1
Name :Mouse Recombinant (E.Coli) Purified Leptin Protein
Name :Mouse Leptin protein Western blot +ve control # 1
Name :Rabbit Anti-Mouse Recomb. Leptin Protein IgG # 1, aff pure
Name :Human Liver-expressed antimicrobial peptide 2 (LEAP2) Control/blocking peptide
Name :Rabbit Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2)
Name :Human Plasma low density lipoprotein (Dil-O-LDL) Oxidized & Dil-labeled, purified
Name :Human Plasma low density lipoprotein (o-LDL) Oxidized, purified
Name :Human Plasma low density lipoprotein (LDL) native, purified
Name :Rabbit Anti-Human Plasma low density lipoprotein (LDL) native, antiserum
Name :Bovine lipoprotein deficient serum
Quantity :5 mL
Quantity :10 mL
Name :Human lipoprotein deficient serum
Name :Human Plasma low density lipoprotein (dil-LDL) Dil-labeled, purified
Price :695 €
Quantity :200 μg
Name :Human Plasma low density lipoprotein (b-LDL) Biotinylated, purified
Name :Human Plasma low density lipoprotein (Dil-Ac-LDL) Acetylated & Dil-labeled, purified
Name :Human Plasma low density lipoprotein (Ac-LDL) Acetylated, purified
Name :Lactate dehydrogenase (~300 U/mg), Chicken Heart
Quantity :20 KU
Name :Lactate dehydrogenase (~550 U/mg), Porcine Muscle
Name :Lactate dehydrogenase (~300 U/mg), Bovine Heart
Name :Lactate dehydrogenase (~200 U/mg), Human Muscle
Quantity :100 U
Name :Lactate dehydrogenase (~350 U/mg), Human Heart
Name :Lactate dehydrogenase (550 U/mg), Rabbit Muscle, freeze dried powder
Quantity :50 KU
Name :Lactate dehydrogenase (300 U/mg), Porcine Heart, freeze dried powder
Name :Recombinant (E. coli) Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) (>95%, His-tag, 63 kda)
Name :Mouse monoclonal Anti-Lymphocytic choriomeningitis virus (LCMV) Capsid Protein 1 (VP1) antibody, culture medium
Name :Rabbit Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP)
Name :Recombinant Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) control for Western blot
Name :Rat Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody positive control serum
Name :Rat Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody negative control serum
Name :Mouse Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody positive control serum
Name :Mouse Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody negative control serum
Name :Lens culinaris Lectin (LCA) coated plate for ELISA (sugar specificity: Glucose)
Quantity :1 Pk
Name :Lens Culinaris Agglutinin (LCA/LcH) purified, unlabeled
Name :Lens culinaris Lectin (LCA)-HRP conjugate
Name :Lens culinaris Lectin (LCA)-FITC conjugate
Name :Lens culinaris Lectin (LCA)-biotin conjugate
Name :Lectin binding native protein (positive control)
Name :Lectin binding native protein (positive control for LCA, SNA, WHGA, ConA, AAL lectins)
Name :Lectin binding native protein (positive control for SNA lectin)
Name :Lectin binding native protein (positive control for ConA, WGA lectins)
Name :Recombinant (E. coli) Mouse Polyoma Virus (KV, Pneumotropic virus) Capsid Protein 1 (VP1), full length (>95% pure, his-tag)
Name :Rabbit Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antiserum
Name :Recombinant Polyoma Virus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) control for Western blot
Name :Rat Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody positive control serum
Name :Rat Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody negative control serum
Name :Mouse Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody positve serum
Name :Mouse Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody negative control serum
Name :Ketamine-BSA conjugate for ELISA/Western
Quantity :0,5 mg
Name :Rabbit Anti-Ketamin IgG aff pure
Quantity :100μg
Name :Monoclonal anti-Ketamine, clone 2
Name :Rabbit Anti-Human KST1 antiserum # 1
Name :Human KST1 Control/blocking peptide # 1
Name :Rabbit Anti-Human KST1
Name :Rabbit Anti-Rat Kilham Virus (KRV) capsid protein VP2 antiserum
Name :Rat Anti-Rat Kilham Virus (KRV) capsid protein VP2 antibody positive control serum
Name :Rat Anti-Rat Kilham Virus (KRV) capsid protein VP2 antibody negative control serum
Name :Recombinant (E. coli) Rat Kilham Virus (KRV) capsid protein VP2 (>95%, his-tag, ~65 Kda)
Name :Recombinant purified Rat Kilham Virus (KRV) capsid protein VP2 control for Western blot
Name :Keyhole Limpet Hemocyanin (KLH, Megathura Crenulata, >98%, low endotoxin, azide free)
Name :Keyhole Limpet Hemocyanin (Megathura Crenulata) Carrier protein
Name :Chicken Anti-KLH (keyhole limpet hemocyanin) #5
Name :Rabbit Anti-KLH (keyhole limpet hemocyanin) antiserum #4
Name :Rabbit Anti-KLH (keyhole limpet hemocyanin) IgG, aff pure
Name :Goat Anti-KLH (keyhole limpet hemocyanin)
Name :monoclonal Anti-KLH (keyhole limpet hemocyanin)
Name :Keyhole Limpet Hemocyanin (KLH)-Agarose af is finity gel for removing KLH antibodies
Price :594 €
Name :Keyhole Limpet Hemocyanin (KLH)-Agarose affinity gel for removing KLH antibodies
Name :Recombinant purified Human Klotho protein (NS0 cells, His-tag; Alpha form; EC domain), active
Quantity :5 μg
Name :Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain), active
Name :Monoclonal Anti-Mouse Klotho IgG, aff pure
Name :Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain) control for western blot
Name :Rabbit Anti-Mouse Klotho Antiserum
Name :Mouse Klotho Control/blocking peptide
Name :Rabbit Anti-Mouse Klotho IgG, aff pure
Name :Kininogen, LMW, Human Plasma
Name :Kininogen, HMW, Human Plasma
Name :Mouse Monoclonal Anti-Human Human Ki67 (Proliferation Marker) peptide IgG
Name :Rabbit Anti-Human Human Ki67 (Proliferation Marker) peptide IgG
Name :Rabbit Anti-Human K-Cl Cotransporter 4 (KCC4) antiserum #2
Name :Human K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #2
Name :Rabbit Anti-Human K-Cl Cotransporter 4 (KCC4)
Name :Rabbit Anti-Mouse K-Cl Cotransporter 4 (KCC4) antiserum #1
Name :Mouse K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #1
Name :Rabbit Anti-Mouse K-Cl Cotransporter 4 (KCC4) IgG #1, aff pure
Name :Rabbit Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) antiserum #2
Name :Human/Mouse K-Cl Cotransporter 3 (KCC3-a) Control/blocking peptide #2
Name :Rabbit Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) IgG #2, aff pure
Name :Rabbit Anti-Human K-Cl Cotransporter 3 (KCC3) antiserum #1
Name :Human K-Cl Cotransporter 3 (KCC3) Control/blocking peptide #1
Name :Rabbit Anti-Human K-Cl Cotransporter 3 (KCC3) IgG #1, aff pure
Name :Rabbit Anti-Rat K-Cl Cotransporter 2 (KCC2)
Name :Rat K-Cl Cotransporter 2 (KCC2) Control/blocking peptide #1
Name :Rabbit Anti-Rat K-Cl Cotransporter 2 (KCC2) IgG #1, aff pure
Name :Rabbit Anti-Rat K-Cl Cotransporter 1 (KCC1)
Name :Rat K-Cl Cotransporter 1 (KCC1) Control/blocking peptide #1
Name :Kallikrein, Human Plasma
Name :Rabbit Anti-Human Plasma Kallikrein IgG
Name :Rabbit Anti-Japanese Encephalitis Virus (JEV) NS1 protein (JEV-NS1) antiserum
Name :Recombinant (HEK) Japanese Encephalitis Virus (JEV) NS1 protein (50 kda >95%, V5 tag, ~46 kda)
Name :Recombinant (E.Coli) Japanese Encephalitis Virus (JEV) prM protein (22 kda, >95%)
Name :Recombinant (E.Coli) Japanese Encephalitis Virus (JEV) gE immunodominant regions (50 kda >95%)
Name :Recombinant Japanese Encephalitis Virus (JEV) envelop protein E (JEV-EP, full length), purified (>95%)
Name :Mouse Monoclonal Anti-Japanese Encephalitis Virus (JEV) NS1 protein (JEV-NS1) IgG.
Name :Monoclonal Anti-Rec. Japanese Encephalitis Virus (JEV) envelop protein E (JEV-EP) Supt.
Name :Monoclonal Anti-Rec. Japanese Encephalitis Virus (JEV) PreM protein
Name :Recombinant (E.Coli) Japanese Encephalitis Virus (JEV) prM protein control for Western blot
Name :Rabbit Anti-Rec.Japanese Encephalitis Virus (JEV) envelop protein E (JEV-EP) antiserum
Name :Recombinant purified Japanese Encephalitis Virus (JEV) envelop protein E protein control for Western blot
Name :Rabbit Anti-Mouse IRS-2
Name :Rabbit Anti-Rat/human Iron regulatory protein 2 (IRP-2)
Name :Rat/human Iron regulatory protein 2 (IRP-2) control/blocking peptide
Name :Rabbit Anti-Rat/human Iron regulatory protein 2 (IRP-2) IgG, aff pure
Name :Rabbit Anti-Rat Iron regulatory protein 1 (IRP-1) antiserum
Name :Rat Iron regulatory protein 1 (IRP-1) control/blocking peptide
Name :Rabbit Anti-Rat Iron regulatory protein 1 (IRP-1)
Name :Rabbit Anti-Rat IRAP (Insulin regulated aminopeptidase) Antiserum #1
Name :Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1
Name :Rabbit Anti-Rat IRAP (Insulin regulated aminopeptidase) IgG #1, aff pure
Name :Rabbit Anti-Human glutamate/GABA Inhibitory protein factor (IPF)
Name :Human glutamate/GABA Inhibitory protein factor (IPF) control/blocking peptide
Name :Rabbit Anti-Human Ice Protease-Activating Factor (IPAF) or CARD12
Name :Human ice Protease-Activating Factor (IPAF) or CARD12 Control/blocking peptide
Name :Rabbit Anti-Human Insulin (recombinant) IgG, aff pure
Name :Rabbit Anti-Human (mouse/rat) Insulin antiserum
Name :Human+Bovine+Porcine Insulin-agarose affinity support
Quantity :0,50 mL
Name :Porcine Insulin (~30 USP U/mg)
Name :Porcine Insulin-agarose affinity support
Name :Recombinant (Yeast) Human Lispro (Insulin analog) (USP grade) for cell culture and ELISA
Name :G. Pig Anti-Human Insulin antiserum
Price :550 €
Name :Recombinant (Yeast) Human Glargine (Insulin analog) (USP grade) for cell culture and ELISA
Name :G. Pig Anti-Human Insulin IgG, pure
Price :1283 €
Quantity :400 μg
Name :Recombinant (Yeast) Human Insulin (USP grade) for cell culture and ELISA
Name :Monoclonal Anti-Rat C-peptide IgG, aff pure
Name :Recombinant (Yeast) Human Insulin (USP grade)-Biotin Conjugate
Price :0 €
Quantity :Custom Service
Name :Recombinant (yeast) Human Insulin-agarose affinity support
Name :Bovine pancreas Insulin (~30 USP U/mg)
Name :Monoclonal Anti-Human Insulin C-terminal pentapeptide IgG, aff pure
Name :Bovine Insulin-agarose affinity support
Name :Monoclonal Anti-Human Pro-Insulin IgG, aff pure
Name :Monoclonal Anti-Human Insulin IgG, aff pure
Name :G. Pig anti-Porcine Insulin antiserum
Name :Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure
Name :Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]
Name :Monoclonal Anti-Human Insulin C-peptide IgG, aff pure
Name :Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
Name :Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure
Name :Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure
Name :Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN]
Name :Mouse iNOS (macrophage) cDNA probe
Quantity :2 μg
Name :Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag)
Name :Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) control for Western
Name :Rabbit Anti-Human NOS-II/iNOS IgG # 1, aff pure
Name :Mouse Monoclonal Anti-Mouse/rat NOS-II/i-NOS peptide
Name :Rabbit Anti-Mouse NOS-II/i-NOS IgG # 2
Name :Mouse i-NOS/NOS-II Control/blocking peptide # 2
Name :Rabbit Anti-Mouse NOS-II/i-NOS Antiserum # 1
Name :Mouse NOS-II/i-NOS Protein for ELISA Standard
Name :Mouse NOS-II/i-NOS Control/blocking peptide # 1
Name :Mouse NOS-II/i-NOS Protein Western Blot +ve Control # 1
Name :Rabbit Anti-Mouse NOS-II/iNOS
Name :Mouse Monoclonal Anti-Influenza B IgG, aff pure
Name :Mouse Monoclonal Anti-Influenza A virus IgG, aff pure
Name :Human IL-2 ELISPOT Set/Kit
Price :1863 €
Quantity :10 plates
Name :Recombinant purified, human Interleukin-1 alpha (IL-1 alpha), active
Name :Recombinant (E.Coli, his-tag) hIKKB-beta
Name :Recombinant purified human IKKB-beta (Sf9; GST-His-IKK-B), active
Name :Recombinant purified human IKB-beta (E., coli; GST-tag; IKB-beta)
Name :Recombinant purified human IKB-alpha (E., coli; GST-tag; IKB-alpha), active
Name :Recombinant purified human IKB-alpha (E., coli; His-tag; 1-317 aa), active
Name :Custom purification of IgY from up to 12 egg yolks
Quantity :1
Name :Custom purification of IgY from up to 6 egg yolks
Name :Recombinant (Sf21) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control
Name :Recombinant (E. coli) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control
Name :Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG
Name :Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7)
Name :Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
Name :Rabbit Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein IgG, aff pure
Name :Recombinant (NSO) Purified Mouse/human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control
Name :Recombinant (E.Coli) Purified human insulin-like growth factor binding protein 6 (IGFBP-6) protein WB +ve control
Name :Monoclonal Anti-mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure
Name :Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
Name :Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
Name :Recombinant (E.Coli) Purified human recomb. human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control
Name :Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
Name :Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
Name :Rabbit Anti-Human Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
Name :Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein IgG
Name :Rabbit Anti-Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein antiserum
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB
Name :Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein
Name :Recombinant (E.Coli) purified Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein
Name :Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein IgG
Name :Rabbit Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) antiserum
Name :Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein
Name :Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein
Name :Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG
Name :Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
Name :Rabbit Anti-bovine Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) antiserum
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein
Name :Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein
Name :Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
Name :Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG #1
Name :Rabbit Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein antiserum
Name :Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
Name :Recombinant (E.coli) purified Human Insulin Like Growth Factor-2 (IGF-2) protein
Name :Recombinant (E.coli) purified Human Insulin Like Growth Factor-1 (IGF-1) protein
Name :Recombinant (E.coli) purified Mouse Insulin Like Growth Factor-1 (IGF-1) protein
Name :Monoclonal Anti-Human Insulin Like Growth Factor-1 IgG1, aff pure
Name :Monoclonal Anti-Human (clone 3)
Name :Monoclonal Anti-Human IgE (clone 2), aff pure
Name :Monoclonal Anti-Human IgE (clone 1), aff pure
Name :Horse Anti-Indian Cobra (Naja naja) venom antiserum
Name :Chicken Anti-Indian Cobra (Naja naja) antiserum
Name :Rabbit Anti-Indian Cobra (Naja naja) venom antiserum
Name :Rabbit Anti-Human Iceberg
Name :Human Iceberg control (blocking) peptide
Name :Rabbit Anti-Human Iceberg IgG, aff. Pure
Name :Recombinant Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gB recombinant protein
Name :Rabbit Anti-Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gB antiserum
Name :Recombinant Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gB protein control for western blot
Name :Hyaluronidase (5000 U/mg), Ovine Testis
Name :Hyaluronidase (300 U/mg), Ovine Testis
Quantity :10 g
Name :Recombinant (E.Coli) purified Human Hexokinase 4/Glucokinase (HXK-4/HK-4/GCK), full length
Name :Recombinant (E.Coli) purified Human Hexokinase 3 (HXK-3/HK-3), full length
Name :Recombinant (E.Coli) purified Human Hexokinase 2 (HXK-2/HK-2), full length
Name :Recombinant (E.Coli) purified Human Hexokinase 1 (HXK-1/HK-1), full length
Name :Mouse Hexokinase 1-4 (HXK1-IV) Control/blocking peptide
Name :Rabbit Anti-Mouse Hexokinases 1-4 (HXK1-IV), IgG, aff pure
Name :Mouse Hexokinase 4/GCK (HXK-IV) Control/blocking peptide
Name :Rabbit Anti-Mouse Hexokinase 4/GCK (HXK-IV), IgG, aff pure
Name :Mouse Hexokinase 3 (HXK-III) Control/blocking peptide
Name :Rabbit Anti-Mouse Hexokinase 3 (HXK-III)
Name :Mouse Hexokinase 2 (HXK-II) Control/blocking peptide
Name :Rabbit Anti-Mouse Hexokinase 2 (HXK-II) IgG, aff pure
Name :Mouse Hexokinase 1 (HXK-I) Control/blocking peptide
Name :Rabbit Anti-Mouse Hexokinase 1 (HXK-I) IgG, aff pure
Name :Recombinant (E. Coli) Hantavirus (HTNV) Nucleoprotein (NP) (GST-tag, >95% Pure)
Name :Rabbit Anti-Hantavirus Nucleoprotein (NP) antiserum
Name :Recombinant (E. Coli) Hantavirus Nucleoprotein (NP), protein control for Western Blot
Name :Human Adult Tissues Protein lysate, Universal
Price :246 €
Name :Human Spinal Cord Tissue Slide (normal) (5 slides/pk)
Quantity :1 pk
Name :Human Uvula Tissue Slide (Benign) (5 slides/pk)
Name :Human Bone Slide (Chondrosarcoma) (5 slides/pk)
Name :Human Cartilage Slide (Benign) (5 slides/pk)
Name :Human Melanoma Tissue Slide (5 slides/pk)
Name :Human Skin Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Skin Tissue Slide (Basal Cell Carcinoma) (5 slides/pk)
Name :Human Skin Tissue Slide (Squamous Cell Carcinoma) (5 slides/pk)
Name :Human Skin Tissue Slide (Benign) (5 slides/pk)
Name :Human Skin Tissue Slide (Normal) (5 slides/pk)
Name :Human Bladder Slide (Papillary Carcinoma) (5 slides/pk)
Name :Human Bladder Slide (Malignant epithelial tumor) (5 slides/pk)
Name :Human Bladder Slide (Normal) (5 slides/pk)
Name :Human Esophogus Slide (Squamous Cell Carcinoma) (5 slides/pk)
Name :Human Gall Bladder Slide (Abnormal) (5 slides/pk)
Name :Human Gall Bladder Slide (Benign) (5 slides/pk)
Name :Human Gall Bladder Slide (Normal) (5 slides/pk)
Name :Human Soft Tissue Slide (Skeletal Muscle Malignant) (5 slides/pk)
Name :Human Soft Tissue Slide (Skeletal Muscle Benign) (5 slides/pk)
Name :Human Soft Tissue Slide (Skeletal Muscle Normal) (5 slides/pk)
Name :Human Soft Tissue Slide (Adipose Abnormal) (5 slides/pk)
Name :Human Soft Tissue Slide (Adipose Liposarcoma) (5 slides/pk)
Name :Human Soft Tissue Slide (Adipose Lipoma) (5 slides/pk)
Name :Human Soft Tissue Slide (Adipose Benign) (5 slides/pk)
Name :Human Soft Tissue Slide (Adipose Normal) (5 slides/pk)
Name :Human Soft Tissue Slide (Adipose Undiagnosed) (5 slides/pk)
Name :Human Soft Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Soft Tissue Slide (Benign) (5 slides/pk)
Name :Human Penis Tissue Slide (Malignant) (5 slides/pk)
Name :Human Salivary Gland Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Salivary Gland Tissue Slide (Mucoepidermoid carcinoma) (5 slides/pk)
Name :Human Urogenital Tissue Slide (Vas Deferens Benign) (5 slides/pk)
Name :Human Urogenital Tissue Slide (Vas Deferens Normal) (5 slides/pk)
Name :Human Urogenital Tissue Slide (Placenta Benign) (5 slides/pk)
Name :Human Urogenital Tissue Slide (Fallopian Tube Abnormal) (5 slides/pk)
Name :Human Urogenital Tissue Slide (Fallopian Tube Benign) (5 slides/pk)
Name :Human Urogenital Tissue Slide (Fallopian Tube normal) (5 slides/pk)
Name :Human Small Intestine Tissue Slide (Squamous Cell Carcinoma) (5 slides/pk)
Name :Human Testis Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Testis Tissue Slide (Normal) (5 slides/pk)
Name :Human Leukemias/Lymphomas Tissue Slide (Mixed Leukemia and Lymphoma) (5 slides/pk)
Name :Human Leukemias/Lymphomas Tissue Slide (Lymphoma) (5 slides/pk)
Name :Human Leukemias/Lymphomas Tissue Slide (Leukemia Spleen) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Tonsil benign) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Lymph node abnormal) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Lymph node malignant) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Lymph node benign) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Lymph node normal) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Appendix Abnormal) (5 slides/pk)
Name :Human Lymphoid Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Uterus Tissue Slide (Adenomyoma) (5 slides/pk)
Name :Human Uterus Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Uterus Tissue Slide (Spindle cell tumor) (5 slides/pk)
Name :Human Uterus Tissue Slide (Papillary serous Adenocarcinoma) (5 slides/pk)
Name :Human Uterus Tissue Slide (Endometrioid Adenocarcinoma) (5 slides/pk)
Name :Human Uterus Tissue Slide (Adenocarcinoma) (5 slides/pk)
Name :Human Uterus Tissue Slide (Benign) (5 slides/pk)
Name :Human Uterus Tissue Slide (Normal) (5 slides/pk)
Name :Human Cervix Slide (Abnormal) (5 slides/pk)
Name :Human Cervix Slide (Squamous Cell Carcinoma) (5 slides/pk)
Name :Human Cervix Slide (Interepithelial Neoplasia (squamous dysplasia)) (5 slides/pk)
Name :Human Cervix Slide (Condyloma acuminatum) (5 slides/pk)
Name :Human Cervix Slide (Benign) (5 slides/pk)
Name :Human Cervix Slide (Normal) (5 slides/pk)
Name :Human Ovary Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Ovary Tissue Slide (Epithelial tumor) (5 slides/pk)
Name :Human Ovary Tissue Slide (Malignant tumor) (5 slides/pk)
Name :Human Ovary Tissue Slide (Benign Sex Chord Stromal tumor) (5 slides/pk)
Name :Human Ovary Tissue Slide (Benign Epithelial Tumor) (5 slides/pk)
Name :Human Ovary Tissue Slide (Benign) (5 slides/pk)
Name :Human Ovary Tissue Slide (Normal) (5 slides/pk)
Name :Human Pancreas Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Pancreas Tissue Slide (Adenocarcinoma) (5 slides/pk)
Name :Human Pancreas Tissue Slide (normal) (5 slides/pk)
Name :Human Thyroid Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Thyroid Tissue Slide (Papillary Carcinoma) (5 slides/pk)
Name :Human Thyroid Tissue Slide (Follicular Carcinoma) (5 slides/pk)
Name :Human Thyroid Tissue Slide (Benign) (5 slides/pk)
Name :Human Spleen Tissue Slide (Benign) (5 slides/pk)
Name :Human Spleen Tissue Slide (Normal) (5 slides/pk)
Name :Human Spleen Tissue Slide (Unknown) (5 slides/pk)
Name :Human Stomach Tissue Slide (Tumor) (5 slides/pk)
Name :Human Stomach Tissue Slide (Abnormal) (5 slides/pk)
Name :Human Stomach Tissue Slide (Carcinoma) (5 slides/pk)
Name :Human Stomach Tissue Slide (Signet Ring Cell Adenocarcinoma) (5 slides/pk)
Name :Human Stomach Tissue Slide (Mucinous adenocarcinoma) (5 slides/pk)
Name :Human Stomach Tissue Slide (Adenocarcinoma) (5 slides/pk)
Name :Human Stomach Tissue Slide (Benign) (5 slides/pk)
Name :Human Stomach Tissue Slide (Normal) (5 slides/pk)
Name :Human Colorectal Colon Slide (Abnormal) (5 slides/pk)
Name :Human Colorectal Colon Slide (Unclassified Carcinoma) (5 slides/pk)
Name :Human Colorectal Colon Slide (Mucinous Carcinoma) (5 slides/pk)
Name :Human Colorectal Slide (Adenocarcinoma) (5 slides/pk)
Name :Human Colorectal Slide (Benign) (5 slides/pk)
Name :Human Colorectal Slide (Normal) (5 slides/pk)
Name :Human Prostate Tissue Slide (Hyperplasia) (5 slides/pk)
Name :Human Heart Slide (Abnormal) (5 slides/pk)