Name : Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
Supplier : ADI
Price :405
SKU : GEN7064167156
| ELISA kit stock availability | Available In Stock |
| ELISA's description | Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
| Category | Antibody Blocking Peptide |
| S type | Synthetic peptide (inquire immunogen) |
| Antibody's host is | see techfile |
| Purification | Affinity purified |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Description | , The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs, The shortest peptides are dipeptides, These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), and unbranched synthetic peptide chains, consisting of 2 amino acids joined by a single peptide bond, continuous, followed by tripeptides, or in continue produced for custom peptide synthesis projects, tetra peptides, till polypeptides that are long, Peptides short amino acid chains or epitopes or blocking antagonists |
| Gene target | / Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
| Short name | Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
| Technique | mouses, peptides, peptide |
| Species | Mouses, Mouse |
| Alternative name | Mouse/rat Insulin B epitope short protein sequence (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
| Alternative technique | peptides |