Filters

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] size: 500 μg 405

Supplier ADI
Price 405
Size 500 μg
ELISA kit stock availabilityAvailable In Stock
ELISA's descriptionMouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
CategoryAntibody Blocking Peptide
S typeSynthetic peptide (inquire immunogen)
Antibody's host issee techfile
PurificationAffinity purified
Test A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin nameMus musculus
Description , The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs, The shortest peptides are dipeptides, These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), and unbranched synthetic peptide chains, consisting of 2 amino acids joined by a single peptide bond, continuous, followed by tripeptides, or in continue produced for custom peptide synthesis projects, tetra peptides, till polypeptides that are long, Peptides short amino acid chains or epitopes or blocking antagonists
Gene target/ Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
Short nameMouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
Technique mouses, peptides, peptide
Species Mouses, Mouse
Alternative nameMouse/rat Insulin B epitope short protein sequence (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
Alternative techniquepeptides

Subscribe to our Newsletter