Total products: 64872
mouse
Filters
SKU Product name Supplier Size Price
GEN6730203272 HSF1 Lentiviral Vector (Mouse) (pShuttle-HA) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN7833721590 MMP-3 Lentiviral Vector (Mouse) (CMV) (pLenti-CMV-GFP-2A-Puro) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN2313750336 Trem2-EGFP Lentiviral Vector (Mouse) (pLenti-Bi-cistronic) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN1997976236 OSKM Lentiviral Vector (Mouse) (pLenti-III) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN2520216094 Orange Lentiviral Vector (Mouse) (pLenti-promoter) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN8855691140 Mouse GotI Lentiviral Vector (Mouse) (pLenti-III-bidirectional promoter) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN2062209346 Mouse Trem2 Lentiviral Vector (Mouse) (pLenti-III-HA) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN7299305446 Sgms1 Lentiviral Vector (Mouse) (CMV) (pLenti-II-CMV-Luc-IRES-GFP) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN2665481814 mir-34b Lentiviral Vector (Mouse) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN1202630931 Granulin Lentiviral Vector (Mouse) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN3498012529 CDC5L Lentiviral Vector (mouse) (pLenti-III-HA/mKate2-N-term) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN7367581737 NKX2-5 Lentiviral Vector (Mouse) (pLenti-Easy-HA) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN5280133130 AKT1 Lentiviral Vector (Mouse) (pLenti-His) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN5574742552 Parg Lentiviral Vector (Mouse) (pLenti-Easy-HA) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN3067690580 ERG Lentiviral Vector (Mouse) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN7388501329 CLTC Lentiviral Vector (Mouse) (pLKO.1) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN1310656632 CLTC Lentiviral Vector (Mouse) (pLKO.1) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN9863463806 CLTC Lentiviral Vector (Mouse) (pLKO.1) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN8669245594 SIAT3 Lentiviral Vector (Mouse) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN4212113857 ADIP Lentiviral Vector (Mouse) Info ABM LENTIVECTORS 1.0 µg DNA 322 €
GEN8940799762 Recombinant Mouse Lactoferrin (>95%, low endotoxin, human cells, his-tag) Info ADI 10 μg 333 €
GEN7781968210 Mouse monoclonal Anti-rat/mouse lactoferrin IgG Info ADI 100 μL 565 €
GEN8637744106 Mouse monoclonal Anti-human lactoferrin Info ADI 100 μL 565 €
GEN5700743099 Mouse Lipin-3 Control/blocking peptide control/blocking peptide #1 Info ADI 100 μg 188 €
GEN8721946782 Rabbit Anti-Mouse Lipin-3 IgG #1, Aff. Pure Info ADI 100 μg 565 €
GEN6785099077 Mouse Lipin-2 Control/blocking peptide control/blocking peptide #1 Info ADI 100 μg 188 €
GEN1789792057 Rabbit Anti-Mouse Lipin-2 IgG #1, Aff. Pure Info ADI 100 μg 565 €
GEN9590211461 Mouse Lipin-1 Control/blocking peptide control/blocking peptide #1 Info ADI 100 μg 188 €
GEN2132726797 Rabbit Anti-Mouse Lipin-1 Info ADI 100 μg 565 €
GEN6008419863 Large Intestineal Mucinous Antigen (LIMA), Clone: LIMA 9B5, Mouse Monoclonal antibody-Human; frozen/paraffin, IH Info ACCURATE MONOCLONALS 1000ul 0 €
GEN7127512140 Large Intestineal Mucinous Antigen (LIMA), Clone: LIMA 2C3, Mouse Monoclonal antibody-Human; frozen/paraffin, IH Info ACCURATE MONOCLONALS 1000ul 0 €
GEN5573984115 Large/Small Intestineal Mucinous Ag. (LIMA & SIMA), predominantly LIMA, Clone: LIMA/sima 4A1, Mouse Monoclonal antibody-Hu;frozen/paraffin, IH Info ACCURATE MONOCLONALS 1000ul 0 €
GEN6587283329 Large/Small Intestineal Mucinous Ag. (LIMA & SIMA), predominantly LIMA, Clone: LIMA/sima 12A4, Mouse Monoclonal X-Hu; frozen/paraffin, IH Info ACCURATE MONOCLONALS 1000ul 0 €
GEN9106429143 Large/Small Intestineal Mucinous Ag. (LIMA & SIMA), predominantly LIMA, Clone: LIMA/sima 10B3, Mouse Monoclonal X-Hu; frozen/paraffin,IH Info ACCURATE MONOCLONALS 1000ul 0 €
GEN9351794949 Mouse Monoclonal Anti-Human Luteinizing Hormone (LH), alpha chain IgG, aff pure Info ADI 1 mg 333 €
GEN5618541723 Mouse Monoclonal Anti-Human Luteinizing Hormone (LH), Beta chain IgG #2 (detection), aff pure Info ADI 100 μg 565 €
GEN1346898460 Mouse Monoclonal Anti-Human Luteinizing Hormone (LH), Beta chain IgG #1 (capture), aff pure Info ADI 100 μg 565 €
GEN5553536657 Mouse Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein Info ADI 50 μg 478 €
GEN2172993807 Mouse Recombinant (E.Coli) Purified Leptin Triple mutant Antagonist Protein Info ADI 10 μg 188 €
GEN3207479606 Rabbit Anti-Mouse Recomb. Leptin Protein antiserum # 1 Info ADI 100 μL 536 €
GEN4775289284 Mouse Recombinant (E.Coli) Purified Leptin Protein Info ADI 5 mg 1058 €
GEN2601752627 Mouse Recombinant (E.Coli) Purified Leptin Protein Info ADI 1 mg 333 €
GEN2124317419 Mouse Leptin protein Western blot +ve control # 1 Info ADI 100 μL 333 €
GEN2082580707 Rabbit Anti-Mouse Recomb. Leptin Protein IgG # 1, aff pure Info ADI 100 μg 565 €
GEN5942134419 Mouse monoclonal Anti-Lymphocytic choriomeningitis virus (LCMV) Capsid Protein 1 (VP1) antibody, culture medium Info ADI 1 mL 565 €
GEN3726427063 Mouse Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody positive control serum Info ADI 1 mL 260 €
GEN3288164328 Mouse Anti-Lymphocytic choriomeningitis virus (LCMV) Nucleoprotein (NP) antibody negative control serum Info ADI 1 mL 188 €
GEN1303377839 Recombinant (E. coli) Mouse Polyoma Virus (KV, Pneumotropic virus) Capsid Protein 1 (VP1), full length (>95% pure, his-tag) Info ADI 10 μg 478 €
GEN1619538908 Mouse Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody positve serum Info ADI 1 mL 260 €
GEN7657333884 Mouse Anti-Polyomavirus (KV, Pneumotropic virus) Capsid Protein 1 (VP1) antibody negative control serum Info ADI 1 mL 188 €
GEN9178450329 Mouse vitamin B12 (VB12) ELISA kit Info KAMIYA 96 well plate 843 €
GEN2512292017 Mouse Osteopontin ELISA kit Info KAMIYA 96 well plate 548 €
GEN4507233722 Mouse Calcitonin (CT) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN8741953303 Mouse Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN8869448770 Mouse ANP ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6198590339 Mouse Isotyping Kit Info KAMIYA 20 well plate 468 €
GEN3280430959 Mouse Fetuin A ELISA kit Info KAMIYA 96 well plate 518 €
GEN8384275423 Mouse Apo-H ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5177584351 Mouse Hydroxylysyl Pyridinoline (Hy-PYD) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN9560513435 Mouse Apolipoprotein B (APOB) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2598133853 Mouse Apolipoprotein A1 (APOA1) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN3652226731 Mouse C Telopeptide of Type I Collagen (CTX1) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN9358036559 Mouse and Rat SP-D ELISA kit Info KAMIYA 96 well plate 1393 €
GEN9342784289 Mouse Anti-TNP IgG ELISA kit Info KAMIYA 96 well plate 748 €
GEN4050761247 Mouse Anti-TNP IgM ELISA kit Info KAMIYA 96 well plate 748 €
GEN2357912262 Mouse Alpha-1 Acid Glycoprotein ELISA kit Info KAMIYA 96 well plate 573 €
GEN7233715128 Mouse Clusterin ELISA kit Info KAMIYA 96 well plate 518 €
GEN5396029490 Mouse Anti-PEG IgG ELISA kit Info KAMIYA 96 well plate 748 €
GEN6366195832 Mouse Anti-PEG IgM ELISA kit Info KAMIYA 96 well plate 748 €
GEN6718226421 Mouse Anti-DNP IgM ELISA kit Info KAMIYA 96 well plate 748 €
GEN5289344032 Mouse Anti-DNP IgG ELISA kit Info KAMIYA 96 well plate 748 €
GEN2572168141 Mouse IL-6 ELISA kit Info KAMIYA 96 well plate 523 €
GEN6411785505 Mouse NGAL (Lipocalin-2) ELISA kit Info KAMIYA 96 well plate 548 €
GEN4585259457 Mouse Myeloperoxidase ELISA kit Info KAMIYA 96 well plate 518 €
GEN2808174739 Mouse Retinol Binding Protein ELISA kit Info KAMIYA 96 well plate 518 €
GEN2383624248 Mouse Cystatin C ELISA kit Info KAMIYA 96 well plate 548 €
GEN7415205071 Mouse Angiopoietin 2 (ANGPT2) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2368429255 Mouse ANGPT1 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6998107850 Mouse Primary Precursor Osteoclasts Culture Kit Info KAMIYA 2 x 10^6 cells 1537 €
GEN3081990660 Mouse Primary Precursor Osteoclasts Culture Kit Info KAMIYA 4 x 10^6 cells 2828 €
GEN6143087611 Mouse Primary Precursor Osteoclasts Culture Kit with Osteoplate Info KAMIYA 2 x 10^6 cells 1773 €
GEN9362930051 Mouse Primary Precursor Osteoclasts Culture Kit with Osteoplate Info KAMIYA 4 x 10^6 cells 3028 €
GEN7557848194 Mouse Cardiac Troponin-I, High Sensitive ELISA kit Info KAMIYA 96 well plate 648 €
GEN5994673746 Mouse KIM-1 ELISA kit Info KAMIYA 96 well plate 561 €
GEN2051985435 Mouse IgG (High Specificity) ELISA kit Info KAMIYA 96 well plate 478 €
GEN5907822982 Mouse/Rat Urocortin 1 ELISA kit Kit Info KAMIYA 96 well plate 1131 €
GEN4351452876 Bovine IgG ELISA kit, No Crossreactivity with Mouse, Rat, Rabbit, or Human IgG Info KAMIYA 96 well plate 548 €
GEN9631184892 Mouse Alkaline Phosphatase (ALP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9794943261 Mouse Adrenocorticotropic Hormone (ACTH) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5786734744 Rat/Mouse Adiponectin ELISA kit Kit Info KAMIYA 96 well plate 1131 €
GEN1145132200 Mouse Tartrate Resistant Acid Phosphatase 5b (TRACP5b) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN6050866900 Mouse C5b9 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN5603117249 Mouse Tenascin C ELISA kit Info KAMIYA 96 well plate 1074 €
GEN6605257098 Mouse Tissue Factor (TF) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN8741672394 Mouse cardiac Troponin T (cTnT) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7367898591 Mouse TRACP5B ELISA kit Info KAMIYA 96 well plate 1074 €
GEN6637861564 Mouse Serum Iron (SIRON) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN4899398686 Mouse SAP ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9683407826 Mouse secreted Phospholipase A2 (sPLA2) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2569812440 Mouse SFTPD ELISA kit Info KAMIYA 96 well plate 1074 €
GEN5793512178 Mouse Platelet Activating Factor (PAF) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7944377179 Mouse Peptide Yy (PYY) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2851481868 Mouse LT C4 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2043925871 Mouse Krebs Von den Lungen 6 (KL-6) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN3788998793 Mouse Insulin like Protein 5 (INSL-5) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN8233697113 Mouse Indoxyl Sulfate (IS) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9374735286 Mouse HSP-47 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7326918172 Mouse and Rat Prolactin ELISA kit Info KAMIYA 96 well plate 1783 €
GEN7989539462 Mouse Hydrogen Sulfide (H2S) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9411437347 Mouse GST ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2245461420 Mouse Glycated Hemoglobin A1c (HbA1c) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9198157684 Mouse Glycated Albumin (GALB) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN5095574013 Mouse FGF-2 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN6676149061 Mouse FABP2 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN5648051442 Mouse Deoxypyridinoline (DPD) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7267803130 Mouse DAO ELISA kit Info KAMIYA 96 well plate 1074 €
GEN4670807187 Mouse C5a ELISA kit Info KAMIYA 96 well plate 1074 €
GEN8366132848 Mouse Complement Component 5 (C5) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7192930834 Mouse Bone Alkaline Phosphatase (BAP) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN6837687987 Mouse Aldosterone (ALD) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7160550327 Mouse Apolipoprotein C3 (ApoC3) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9860760242 Mouse Apolipoprotein B (ApoB) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7641891407 Mouse ApoA5 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9114449719 Mouse Apolipoprotein A1 (Apo-A1) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN1894259684 Mouse Aquaporin 2 (AQP-2) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN1472541874 Mouse Anti-SRBC IgG Info KAMIYA 96 well plate 748 €
GEN6495170892 Mouse Adenosine Triphosphate (ATP) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN8329442546 Mouse Anti-SRBC IgM Info KAMIYA 96 well plate 748 €
GEN2049434949 Mouse Anti-KLH IgG Info KAMIYA 96 well plate 748 €
GEN7521472894 Mouse Anti-KLH IgM Info KAMIYA 96 well plate 748 €
GEN9783247391 Mouse Activated Protein C (APC) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9410309806 Mouse IgG2C ELISA kit Info KAMIYA 96 well plate 453 €
GEN8311706471 Mouse ACTa2 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9968122259 Mouse Prealbumin ELISA kit Info KAMIYA 96 well plate 548 €
GEN8987658375 Mouse Alpha-1-Acid Glycoprotein (a1AGP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2031518989 Mouse Tissue Factor (TF) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN3290831026 Mouse SFTPD ELISA kit Info KAMIYA 96 well plate 1074 €
GEN3131033242 Mouse SPA ELISA kit Info KAMIYA 96 well plate 1074 €
GEN4866948807 Mouse Prolactin ELISA kit Info KAMIYA 96 well plate 1074 €
GEN5652995431 Mouse PF4 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN1987088249 Mouse PAI1 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN3890336900 Mouse PEDF ELISA kit Info KAMIYA 96 well plate 1074 €
GEN1163163708 Mouse PTHrP ELISA kit Info KAMIYA 96 well plate 1074 €
GEN4031505655 Mouse Osteocalcin ELISA kit Info KAMIYA 96 well plate 1074 €
GEN8430388216 Mouse Serum Amyloid A (SAA) Reference Serum Info KAMIYA 1 mL 253 €
GEN8151039689 Mouse Glucagon ELISA kit Info KAMIYA 96 well plate 1074 €
GEN1118165627 Mouse Erythropoietin ELISA kit Info KAMIYA 96 well plate 1074 €
GEN6971431328 Mouse Early Growth Response Protein 1 ELISA kit Kit (EGR1) Info KAMIYA 96 well plate 1074 €
GEN4506550578 Mouse C5 ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2169049758 Mouse Coagulation Factor V ELISA kit Info KAMIYA 96 well plate 1074 €
GEN4978570586 Mouse Brain Natriuretic Peptide (BNP) ELISA kit Info KAMIYA 96 well plate 1074 €
GEN2110433932 Mouse Bcl2 Associated X Protein ELISA kit Info KAMIYA 96 well plate 1074 €
GEN9753888425 Mouse APOB ELISA kit Info KAMIYA 96 well plate 1074 €
GEN7859584846 Mouse and Rat Corticosterone ELISA kit Info KAMIYA 96 well plate 1131 €
GEN9922701464 Mouse and Rat Obestatin ELISA kit Info KAMIYA 96 well plate 1131 €
GEN8152205387 Rat and Mouse Skeletal Muscle Myosin Light Chain-1 ELISA kit Info KAMIYA 96 well plate 593 €
GEN4422627709 Rat and Mouse Cardiac Myosin Light Chain-1 ELISA kit Info KAMIYA 96 well plate 593 €
GEN2057049276 Mouse Skeletal Muscle Troponin-1 ELISA kit Info KAMIYA 96 well plate 793 €
GEN7025466853 Mouse H-FABP ELISA kit Info KAMIYA 96 well plate 593 €
GEN9589657199 Mouse Cardiac Troponin-I ELISA kit Info KAMIYA 96 well plate 593 €
GEN3988121513 Mouse Cardiac Troponin-I ELISA kit Info KAMIYA 96 well plate 593 €
GEN8175861693 Mouse L-FABP ELISA kit Info KAMIYA 96 well plate 648 €
GEN1194997745 Mouse Clusterin ELISA kit Info KAMIYA 96 well plate 548 €
GEN6634832417 Mouse alpha-macroglobulin ELISA kit Info KAMIYA 96 well plate 523 €
GEN8382085568 Mouse Plasminogen ELISA kit Info KAMIYA 96 well plate 498 €
GEN5225209635 Mouse Myoglobin ELISA kit Info KAMIYA 96 well plate 498 €
GEN9221129001 Mouse IgM ELISA kit Info KAMIYA 96 well plate 389 €
GEN6500030776 Mouse IgG3 ELISA kit Info KAMIYA 96 well plate 403 €
GEN3975479183 Mouse IgG2B ELISA kit Info KAMIYA 96 well plate 403 €
GEN4619060327 Mouse IgG2A ELISA kit Info KAMIYA 96 well plate 403 €
GEN7860406922 Mouse IgG1 ELISA kit Info KAMIYA 96 well plate 403 €
GEN4905633175 Mouse IgG ELISA kit Info KAMIYA 96 well plate 389 €
GEN5812513972 Mouse IgE ELISA kit Info KAMIYA 96 well plate 408 €
GEN1428738426 Mouse IgA ELISA kit Info KAMIYA 96 well plate 389 €
GEN6563439679 Mouse Hemoglobin ELISA kit Info KAMIYA 96 well plate 498 €
GEN1347318774 Mouse Fibronectin ELISA kit Info KAMIYA 96 well plate 548 €
GEN1990647103 Mouse Fibrinogen ELISA kit Info KAMIYA 96 well plate 448 €
GEN9074252177 Mouse Ferritin ELISA kit Info KAMIYA 96 well plate 498 €
GEN2242874403 Mouse Alpha-1 Anti-trypsin ELISA kit Info KAMIYA 96 well plate 548 €
GEN6880829458 GLP-1 EIA, Human, Mouse, Rat Info KAMIYA 96 test 1131 €
GEN9586438245 Corticotropin-Releasing Factor ELISA kit, Mouse & Rat Info KAMIYA 96 test 1238 €
GEN1455655730 Glucagon EIA, Mouse, Rat and Human Info KAMIYA 96 test 1238 €
GEN1792237573 Leptin ELISA kit, Mouse Info KAMIYA 1 kit 1024 €
GEN8269653919 Urocortin 3 EIA, Mouse and Rat Info KAMIYA 96 test 1131 €
GEN1838830125 Urocortin 2 EIA, Mouse Info KAMIYA 96 test 1131 €
GEN7626387574 GLP-2 EIA, Mouse Info KAMIYA 96 test 1131 €
GEN6453462312 C-Peptide EIA, Mouse Info KAMIYA 96 test 1238 €
GEN9122130403 C-Peptide II EIA,Mouse Info KAMIYA 96 test 1238 €
GEN3508325370 C-Peptide I EIA, Mouse Info KAMIYA 96 test 1238 €
GEN7263616219 Ghrelin ELISA kit, Desacyl, human, mouse and rat Info KAMIYA 96 test 978 €
GEN1824527664 Ghrelin ELISA kit, Active, human, mouse and rat Info KAMIYA 96 test 978 €
GEN6416623537 Mouse Transferrin ELISA kit Info KAMIYA 1 kit 371 €
GEN2460657275 Mouse Serum Amyloid P ELISA kit Info KAMIYA 1 kit 549 €
GEN1492385367 Mouse SAA ELISA kit Info KAMIYA 1 kit 471 €
GEN7660082309 Mouse Hemopexin ELISA kit Info KAMIYA 1 kit 498 €
GEN7531217831 Mouse Complement C3 ELISA kit Info KAMIYA 1 kit 453 €
GEN1147793109 Mouse Microalbumin ELISA kit Info KAMIYA 1 kit 371 €
GEN1761962810 Mouse Antidiuretic Hormone (ADH) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2947537114 Mouse Dystrophin (DMD) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7259268766 Mouse Uromodulin (UMOD) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7528490259 Mouse Corticosteroid Binding Globulin (CBG) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN8046637115 Mouse PGLYRP1 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2303510821 Mouse Deoxyribonuclease I Like Protein 3 (DNASE1L3) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2853909488 Mouse Angiopoietin Like Protein 4 (ANGPTL4) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2867146030 Mouse Glypican 1 (GPC1) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5227973276 Mouse Gamma Aminobutyric Acid A Receptor Alpha 2 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7408159798 Mouse Fibroblast Growth Factor 15 (FGF15) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN8227101942 Mouse Oxidized Low Density Lipoprotein (OxLDL) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9443345028 Mouse Beta-2-Microglobulin (b2M) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN4905663204 Mouse Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN4960334057 Mouse Granzyme M (GZM-M) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9759839203 Mouse Tissue Factor (TF) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN1776198244 Mouse Tissue Factor Pathway Inhibitor (TFPI) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6980010489 Mouse T4 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN4425615543 Mouse Thyroid Stimulating Hormone (TSH) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9086639079 Mouse Thrombospondin 1 (THBS1) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN1978805370 Mouse Thrombin/Antithrombin Complex (TAT) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN1472289591 Mouse TAFI ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9889127746 Mouse Terminal Complement Complex C5b-9 (C5b-9) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9285489455 Mouse Substance P (SP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5288415756 Mouse REN ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9258295772 Mouse Prothrombin Fragment 1+2 (F1+2) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7988927255 Mouse Protein C (PROC) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9777147448 Mouse Procalcitonin (PCT) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN8463861131 Mouse PAF ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7601434378 Mouse PAI2 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6901476125 Mouse PTH ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9961630141 Mouse Osteocalcin (OC) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6248802302 Mouse N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN3698402224 Mouse Myeloperoxidase (MPO) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN1740586080 Mouse Matrix Metalloproteinase 7 (MMP7) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5559162836 Mouse Matrix Metalloproteinase 12 (MMP12) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7900473789 Mouse Matrix Metalloproteinase 1 (MMP1) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2926040643 Mouse Macrophage Migration Inhibitory Factor (MIF) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7154853547 Mouse Low Density Lipoprotein (LDL) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7388155522 Mouse Lactoferrin ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5037765407 Mouse Interleukin 31 (IL31) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN3163463569 Haptoglobin ELISA kit, Mouse Info KAMIYA 96 well plate 498 €
GEN6578013925 Mouse Tumor Necrosis Factor Alpha (TNF-a) ELISA kit Info KAMIYA 96 well plate 505 €
GEN5317586020 Mouse Interleukin-6 ELISA kit Info KAMIYA 96 well plate 498 €
GEN9752718362 Mouse Hepcidin (Hepc) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN4459806739 Mouse Granzyme A (GZMA) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2595964427 Mouse Galectin 9 (GAL9) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN3232254505 Mouse Fibrinogen Degradation Product (FDP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9777625110 Mouse Alpha-Fetoprotein (aFP) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2048377259 Mouse D-Dimer (D2D) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN7132764158 TNF alpha, Mouse Info KAMIYA 96 well plate 681 €
GEN9641587542 Mouse Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5012472451 Mouse Cross Linked C-Telopeptide Of Type I Collagen (CTXI) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5332102998 Mouse Reference Serum 2 Info KAMIYA 1 mL 253 €
GEN3363919403 Mouse Connective Tissue Growth Factor (CTGF) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2707528764 Mouse Complement Factor H (CFH) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6960805644 Mouse CF-B ELISA kit Info KAMIYA 96 well plate 1138 €
GEN9339237058 Mouse Complement Component 3a (C3a) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN3283521946 Mouse Complement Component 5a (C5a) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN6228532401 Mouse Complement Component 5 (C5) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2358591006 Mouse Ferritin Heavy Chain 1 (FTH-1) ELISA kit Info KAMIYA 96 well plate 1068 €
GEN5377076395 Mouse Collagen Type IV (COL4) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN4067917510 Mouse Leptin ELISA kit Info KAMIYA 96 well plate 505 €
GEN6999935992 GLP-1 , Inactive form (Human, Mouse, Rat) ELISA kit Info KAMIYA 96 well plate 973 €
GEN6488564422 Mouse LRG Assay Kit, ELISA kit Info KAMIYA 96 well plate 913 €
GEN2788089073 N-ERC/Mesothelin (Mouse) ELISA kit Info KAMIYA 96 well plate 891 €
GEN8243060647 CCL8/MCP2 (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN8867395736 IL-6 (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN8907000851 Mouse F2 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN4266918610 GIP (Mouse) ELISA kit Info KAMIYA 96 well plate 970 €
GEN8482954054 Intact Angiotensinogen (Mouse) ELISA kit Info KAMIYA 96 well plate 952 €
GEN2352626762 Amyloid ß (1-42) mouse, Rat ELISA kit Info KAMIYA 96 well plate 813 €
GEN6392481353 Amyloid Beta (1-40) (Mouse/Rat) ELISA kit Info KAMIYA 96 well plate 652 €
GEN5526241562 sAPP? (Mouse/Rat) (highly sensitive) ELISA kit Info KAMIYA 96 well plate 813 €
GEN4737637803 sAPP?-w (Mouse) ELISA kit Info KAMIYA 96 well plate 913 €
GEN1601623882 Angiotensinogen Total (Mouse) ELISA kit Info KAMIYA 96 well plate 891 €
GEN8320602625 Angiopoietin-Like 3 (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN3438191200 Osteopontin (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN5467174415 Osteopontin N-half (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN7331890881 GIP (Total) (Mouse) ELISA kit Info KAMIYA 96 test 913 €
GEN1859808240 c-MPL/TPOR (Mouse) ELISA kit Info KAMIYA 96 well plate 913 €
GEN4116611320 Leptin (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN9932553333 Mouse Embryo Cryopreservation Kit Info KAMIYA 1 kit 750 €
GEN1366129150 Mouse Cholecystokinin (CCK) ELISA kit Info KAMIYA 96 well plate 1138 €
GEN2396215455 MIP-2 (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN3830969020 Mouse CCK8 ELISA kit Info KAMIYA 96 well plate 1138 €
GEN5434625656 GRO/KC (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN6664604372 VEGF (Mouse) ELISA kit Info KAMIYA 96 well plate 791 €
GEN4961314577 Mouse and rat LBP ELISA kit Info KAMIYA 96 well plate 663 €
GEN7874034294 Mouse CD14 ELISA kit Info KAMIYA 96 well plate 663 €
GEN5918025447 Mouse Reference Serum 1 Info KAMIYA 1 mL 253 €
GEN5814384326 Mouse hsCRP ELISA kit Kit Info KAMIYA 1 kit 543 €
GEN5481447828 Caiman beta2-Microglobulin, Clone: KSK003-01, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 0.2mg 1234 €
GEN5573565791 Caiman Factor B Complement, unactivated intact, native activated Bb fragment, Clone: KSK002-01, Mouse Monoclonal antibody-; ELISA/WB Info ACCURATE MONOCLONALS 200 ul 1234 €
GEN7363200893 Chicken MHC Class I, alpha, native & denatured, Clone: KSK001-03, Mouse Monoclonal antibody-; WB/flow/IP/affinity purification Info ACCURATE MONOCLONALS 200 ul 1234 €
GEN7240993306 Chicken MHC Class II, beta chain, native & denatured, Clone: KSK001-03, Mouse Monoclonal antibody-; WB/IH/flow/IP/affinity purification Info ACCURATE MONOCLONALS 200 ul 1234 €
GEN4577206924 Chicken MHC Class II, beta, Clone: KSK001-01, Mouse Monoclonal antibody-; WB/flow/IP/affinity purification Info ACCURATE MONOCLONALS 200 ul 0 €
GEN1896297444 Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain), active Info ADI 10 μg 333 €
GEN2757621753 Monoclonal Anti-Mouse Klotho IgG, aff pure Info ADI 100 μg 565 €
GEN1315933593 Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain) control for western blot Info ADI 100 μL 333 €
GEN1918308072 Rabbit Anti-Mouse Klotho Antiserum Info ADI 100 μL 536 €
GEN3602280503 Mouse Klotho Control/blocking peptide Info ADI 100 μg 188 €
GEN7929690334 Rabbit Anti-Mouse Klotho IgG, aff pure Info ADI 100 μg 565 €
GEN3947943713 Mouse Monoclonal Anti-Human Human Ki67 (Proliferation Marker) peptide IgG Info ADI 100 μL 565 €
GEN2851183665 Rabbit Anti-Mouse K-Cl Cotransporter 4 (KCC4) antiserum #1 Info ADI 100 μL 536 €
GEN3273112351 Mouse K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #1 Info ADI 100 μg 188 €
GEN4371591831 Rabbit Anti-Mouse K-Cl Cotransporter 4 (KCC4) IgG #1, aff pure Info ADI 100 μg 565 €
GEN8519826451 Rabbit Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) antiserum #2 Info ADI 100 μL 536 €
GEN5934005694 Human/Mouse K-Cl Cotransporter 3 (KCC3-a) Control/blocking peptide #2 Info ADI 100 μg 188 €
GEN5690358047 Rabbit Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) IgG #2, aff pure Info ADI 100 μg 565 €
GEN3686274016 ImmuChem ImmunoHistoChemistry Kit: Biotinylated Anti-mouse IgG Antibody Info BIOCHAIN 1.0 ml 134 €
GEN5030048021 Attoglow Western Blot Analysis Kit- with Millennium Enhancer, Anti mouse secondary antibody Info BIOCHAIN 2500 cm<sup>2</sup> 305 €
GEN2225905482 Attoglow Western Blot Analysis Kit- with Millennium Enhancer, Anti mouse secondary antibody Info BIOCHAIN 1200 cm<sup>2</sup> 241 €
GEN8344041883 Adiponectin ( mouse ) Elisa Assay Kit 96assays Info APE 96assays 948 €
GEN1830959232 Mouse Monoclonal Anti-Japanese Encephalitis Virus (JEV) NS1 protein (JEV-NS1) IgG. Info ADI 100 μL 565 €
GEN5707682526 Hemoglobin S+C, B6 Val/Lys, Clone: SC114077, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN3988087382 Myoglobin, Clone: M-3-416, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN3378406520 Myoglobin, Clone: M-2-167, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN8184804488 Myoglobin, Clone: M1101, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN3408769323 Hemoglobin H, Clone: H143203, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN4561040841 Hemoglobin G-Philadelphia, Clone: GP112076, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN2585641223 Hemoglobin F, Gamma Chain, Clone: G111491, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN6117268143 Hemoglobin Epsilon Chain, Embryonic, Clone: E1276, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN1222281934 Hemoglobin A2, delta chain, Clone: D117107, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN6268132330 Hemoglobin C, B6 Lys, Clone: C112655, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN9383729777 Hemoglobin A, B6 GLu, Clone: B6123456, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN9893637162 Hemoglobin A, beta 8-12 (A5-9), Clone: B10118946, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN1510879148 Hemoglobin A (alpha chain), Clone: S20-1-58782, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 0 €
GEN3413556541 Rabbit Anti-Mouse IRS-2 Info ADI 100 μg 565 €
GEN3882726899 Rabbit Anti-Human (mouse/rat) Insulin antiserum Info ADI 100 μL 536 €
GEN4764923156 Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure Info ADI 100 μg 565 €
GEN7350208029 Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] Info ADI 500 μg 405 €
GEN7064167156 Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] Info ADI 500 μg 405 €
GEN7690167842 Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure Info ADI 100 μL 565 €
GEN2262969739 Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure Info ADI 100 μL 565 €
GEN8360369156 Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN] Info ADI 500 μg 333 €
GEN8997737649 Mouse iNOS (macrophage) cDNA probe Info ADI 2 μg 521 €
GEN7061046029 Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) Info ADI 50 μg 913 €
GEN6666488228 Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) Info ADI 10 μg 333 €
GEN1223643592 Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) control for Western Info ADI 100 μL 333 €
GEN4028876635 Mouse Monoclonal Anti-Mouse/rat NOS-II/i-NOS peptide Info ADI 100 μL 565 €
GEN9633126500 Rabbit Anti-Mouse NOS-II/i-NOS IgG # 2 Info ADI 100 μL 536 €
GEN9857657413 Mouse i-NOS/NOS-II Control/blocking peptide # 2 Info ADI 100 μg 188 €
GEN7259488293 Rabbit Anti-Mouse NOS-II/i-NOS Antiserum # 1 Info ADI 100 μL 536 €
GEN1219043712 Mouse NOS-II/i-NOS Protein for ELISA Standard Info ADI 5 μg 478 €
GEN8080920330 Mouse NOS-II/i-NOS Control/blocking peptide # 1 Info ADI 100 μg 188 €
GEN3743252394 Mouse NOS-II/i-NOS Protein Western Blot +ve Control # 1 Info ADI 100 μL 333 €
GEN9557818478 Rabbit Anti-Mouse NOS-II/iNOS Info ADI 100 μg 565 €
GEN7624843447 MD-2 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN1848616598 MD-2 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN3797884959 MyD88 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN5471415022 Mouse Monoclonal Anti-Influenza B IgG, aff pure Info ADI 100 μg 565 €
GEN9083509115 Mouse Monoclonal Anti-Influenza A virus IgG, aff pure Info ADI 100 μg 565 €
GEN5683417129 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN6477873620 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN7040258904 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN7632835849 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN1383406882 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN7341307363 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN7986656894 Hemagglutinin Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN5786361539 DC-SIGN Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN3982312206 DC-SIGN Mouse Monoclonal Antibody Info ZYAGEN 0.1mg 491 €
GEN3968296547 ORAI1 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN9334212386 ORAI1 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN3112261312 CD4 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN3650735079 CD4 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN9452577615 IL-33 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN1306898852 IL-33 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN3441899424 ORAI3 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN8798273705 ORAI3 Mouse Monoclonal Antibody Info ZYAGEN 0.1 mg 491 €
GEN9381324695 Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG Info ADI 100 μg 565 €
GEN8849179174 Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB Info ADI 100 μL 333 €
GEN2408396788 Recombinant (NSO) Purified Mouse/human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control Info ADI 10 μg 405 €
GEN2315576542 Monoclonal Anti-mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure Info ADI 100 μg 565 €
GEN3591616854 Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB Info ADI 100 μL 333 €
GEN3221768141 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein Info ADI 10 μg 405 €
GEN7713750159 Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein Info ADI 100 μg 565 €
GEN2292062115 Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein Info ADI 100 μL 333 €
GEN3456977735 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein Info ADI 10 μg 405 €
GEN9838223534 Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control Info ADI 100 μL 333 €
GEN4172386939 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein Info ADI 10 μg 405 €
GEN4831415259 Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG Info ADI 100 μg 565 €
GEN2225123239 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB Info ADI 100 μL 333 €
GEN8459536108 Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein Info ADI 100 μg 565 €
GEN3466856596 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB Info ADI 100 μL 333 €
GEN8215592727 Recombinant (E.coli) purified Mouse Insulin Like Growth Factor-1 (IGF-1) protein Info ADI 10 μg 405 €
GEN6335534819 WAF-1, p21, 21kD, Clone: WA-1, Mouse Monoclonal antibody-Human; frozen/paraffin, IH Info ACCURATE MONOCLONALS 1000ul 465 €
GEN9843891450 CD45RO, T-Cell subset, Thymocyte, Monocyte, Granulocyte, Clone: UCHL1, Mouse Monoclonal antibody-; frozen/paraffin Info ACCURATE MONOCLONALS 1000ul 528 €
GEN2906110008 Tubulin, Clone: 655, Mouse Monoclonal antibody- Info ACCURATE MONOCLONALS 1000ul 506 €
GEN1819110812 Thyroid Transcription Factor 1 (TTF-1), , 40kD, Clone: 8G7G3/1, Mouse Monoclonal antibody-Human; frozen/paraffin, IH Info ACCURATE MONOCLONALS 1000ul 489 €
GEN7403370473 Thyroglobulin, Clone: 14/14, Mouse Monoclonal antibody- Info ACCURATE MONOCLONALS 1000ul 506 €
GEN6389546247 Tenascin, Clone: T2H5, Mouse Monoclonal antibody-Human Info ACCURATE MONOCLONALS 1000ul 465 €