Filters

ABR Antibody / Active BCR related

ABR Antibody / Active BCR related size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenABR / Active BCR related
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ABR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q12979
PurityAntigen affinity
Description Alternatively spliced transcript variants have been reported for this gene, Functional studies in mice determined that this protein plays a role in vestibular morphogenesis, The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins, This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22
ImmunogenAmino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the ABR antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization membranous, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetABR / Active BCR related
Short nameABR Antibody / Active BCR related
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameactive BCR-related (Antibody to) / functionnal BCR related
Alternative techniqueantibodies
Alternative to gene target ABR and IDBG-14430 and ENSG00000159842 and 29, ABR and IDBG-632555 and ENSBTAG00000008424 and 515556, Abr and IDBG-200937 and ENSMUSG00000017631 and 109934, MDB, Plasma membranes, Rac GTPase activator activity, this GO :0005089 and Rho guanyl-nucleotide exchange factor activity and molecular function this GO :0005096 and GTPase activator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007420 and brain development and biological process this GO :0016020 and membrane and cellular component this GO :0030036 and actin cytoskeleton organization and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030675 and Rac GTPase activator activity and molecular function this GO :0032321 and positive regulation of Rho GTPase activity and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0035023 and regulation of Rho protein signal transduction and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042472 and inner ear morphogenesis and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043314 and negative regulation of neutrophil degranulation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050885 and neuromuscular process controlling balance and biological process this GO :0051056 and regulation of small GTPase mediated signal transduction and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0005089: Rho guanyl-nucleotide exchange factor activity, this GO :0005089: Rho guanyl-nucleotide exchange factor activity and also this GO :0005096: GTPase activator activity and also this GO :0005515: protein binding and also this GO :0030675: Rac GTPase activator activity, this GO :0005096: GTPase activator activity, this GO :0005515: protein binding, this GO :0030675: Rac GTPase activator activity, active BCR-related
Identity 1014
Gene BCR
Long gene name BCR, RhoGEF and GTPase activating protein
Synonyms gene D22S11 BCR1
Synonyms gene name breakpoint cluster region
Synonyms D22S662 CML PHL ALL
Locus 22q11, 23
Discovery year 1986-01-01
Entrez gene record 613
Pubmed identfication 1657398 18070886
RefSeq identity NM_004327
Classification Rho guanine nucleotide exchange factors Pleckstrin homology domain containing C2 domain containing
Havana BLAST/BLAT OTTHUMG00000150655
Locus Specific Databases LRG_1112

Similar products

Subscribe to our Newsletter