Filters

ACAA2 Antibody

ACAA2 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenACAA2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ACAA2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P42765
PurityAntigen affinity
Description ACAA2 has been shown to be a functional BNIP3 binding partner, Additionally, The ACAA2 gene encodes a 41, The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral, Unlike most mitochondrial matrix proteins, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene, it contains a non-cleavable amino-terminal targeting signal, mitochondrial, which provides a possible link between fatty acid metabolism and cell apoptosis, 3-Ketoacyl-CoA thiolase, 9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides
ImmunogenAmino acids 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD from the human protein were used as the immunogen for the ACAA2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACAA2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetACAA2
Short nameACAA2 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameACAA2 (Antibody to)
Alternative techniqueantibodies
Identity 83
Gene ACAA2
Long gene name acetyl-CoA acyltransferase 2
Synonyms gene name acetyl-Coenzyme A acyltransferase 2
Synonyms DSAEC
Synonyms name mitochondrial 3-oxoacyl-Coenzyme A thiolase
Locus 18q21, 1
Discovery year 1999-09-28
GenBank acession D16294
Entrez gene record 10449
Pubmed identfication 8241273
RefSeq identity NM_006111
Havana BLAST/BLAT OTTHUMG00000132667

Similar products

Subscribe to our Newsletter