Filters

ACADVL Antibody / VLCAD

ACADVL Antibody / VLCAD size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenACADVL / VLCAD
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ACADVL antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P49748
PurityAntigen affinity
Description A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy, Alternative splicing results in multiple transcript variants encoding different isoforms, The protein encoded by this gene is targeted to the inner mitochondrial membrane, This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway, Very long-chain specific acyl-CoA dehydrogenase
ImmunogenAmino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACADVL antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetACADVL / VLCAD
Short nameACADVL Antibody / VLCAD
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameACADVL (Antibody to) / VLCAD
Alternative techniqueantibodies
Identity 92
Gene ACADVL
Long gene name acyl-CoA dehydrogenase, very long chain
Synonyms gene name acyl-Coenzyme A dehydrogenase, very long chain
Synonyms VLCAD LCACD ACAD6
Locus 17p13, 1
Discovery year 1996-05-30
GenBank acession BC012912
Entrez gene record 37
Pubmed identfication 8921384
RefSeq identity NM_000018
Classification Acyl-CoA dehydrogenase family
Havana BLAST/BLAT OTTHUMG00000102157

Similar products

Subscribe to our Newsletter