Filters

ACTN3 Antibody

ACTN3 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenACTN3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ACTN3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q08043
PurityAntigen affinity
Description An allelic polymorphism in this gene results in both coding and non-coding variants, The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line, The non-functional allele of this gene is associated with elite athlete status, This gene encodes a member of the alpha-actin binding protein gene family, This protein is involved in crosslinking actin containing thin filaments, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene, the reference genome represents the coding allele, Alpha-actinin-3
ImmunogenAmino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACTN3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetACTN3
Short nameACTN3 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name a 3 (gene/pseudogene) (Antibody to), actinin
Alternative techniqueantibodies
Alternative to gene target ACTN3 and IDBG-409425 and ENSG00000248746 and 89, ACTN3 and IDBG-644440 and ENSBTAG00000022244 and 539375, Actn3 and IDBG-130128 and ENSMUSG00000006457 and 11474, Cell surfaces, actin filament binding, alpha 3 (gene/pseudogene), this GO :0003779 and actin binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0005884 and actin filament and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006936 and muscle contraction and biological process this GO :0008307 and structural constituent of muscle and molecular function this GO :0030017 and sarcomere and cellular component this GO :0030018 and Z disc and cellular component this GO :0030049 and muscle filament sliding and biological process this GO :0031143 and pseudopodium and cellular component this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0048041 and focal adhesion assembly and biological process this GO :0051015 and actin filament binding and molecular function, this GO :0003779: actin binding, this GO :0003779: actin binding and also this GO :0005178: integrin binding and also this GO :0005509: calcium ion binding and also this GO :0005515: protein binding and also this GO :0008307: structural constituent of muscle and also this GO :0042803: protein homodimerization activity and also this GO :0051015: actin filament binding, this GO :0005178: integrin binding, this GO :0005509: calcium ion binding, this GO :0005515: protein binding, this GO :0008307: structural constituent of muscle, this GO :0042803: protein homodimerization activity, this GO :0051015: actin filament binding, actinin
Identity 165
Gene ACTN3
Long gene name actinin alpha 3 (gene/pseudogene)
Synonyms gene name actinin, alpha 3
Locus 11q13, 2
Discovery year 1991-07-16
GenBank acession M86407
Entrez gene record 89
Pubmed identfication 1339456
RefSeq identity NM_001104
Classification Actinins
Havana BLAST/BLAT OTTHUMG00000160815

Similar products

Subscribe to our Newsletter