Filters

AK1 Antibody / Adenylate Kinase 1

AK1 Antibody / Adenylate Kinase 1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAK1 / Adenylate Kinase 1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis AK1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P00568
PurityAntigen affinity
Description Alternative splicing of this gene results in multiple transcript variants encoding different isoforms, Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia, This gene is highly expressed in skeletal muscle, brain and erythrocytes, This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments
ImmunogenAmino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AK1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAK1 / Adenylate Kinase 1
Short nameAK1 Antibody / Adenylate Kinase 1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameAK1 (Antibody to) / Adenylate phosphorylation catalyst 1
Alternative techniqueantibodies
Identity 361
Gene AK1
Long gene name adenylate kinase 1
Locus 9q34, 11
Discovery year 1986-01-01
GenBank acession J04809
Entrez gene record 203
Classification Adenylate kinases
Havana BLAST/BLAT OTTHUMG00000020722

Similar products

Subscribe to our Newsletter