Name : ALDH7A1 Antibody
Supplier : NJS POLY
Price :406
SKU : GEN1458774152
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | ALDH7A1 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer | 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use | This ALDH7A1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P49419 |
| Purity | Antigen affinity |
| Description | An additional variant encoding a different isoform has also been found for this gene, It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix, Mutations in this gene are associated with pyridoxine-dependent epilepsy, Recent reports show that this protein is found both in the cytosol and the mitochondria, Several related pseudogenes have also been identified, The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family, These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation, This particular member has homology to a previously described protein from the green garden pea, also known as ALDH7A1 or antiquitin, and the two forms likely arise from the use of alternative translation initiation sites, is an enzyme that in humans is encoded by the ALDH7A1 gene, member A1, the 26g pea turgor protein, Aldehyde dehydrogenase 7 family |
| Immunogen | Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ALDH7A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | ALDH7A1 |
| Short name | ALDH7A1 Antibody |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | ALDH7A1 (Antibody to) |
| Alternative technique | antibodies |
| Identity | 877 |
| Gene | ALDH7A1 |
| Long gene name | aldehyde dehydrogenase 7 family member A1 |
| Synonyms gene | ATQ1 |
| Synonyms gene name | aldehyde dehydrogenase 7 family, member A1 |
| Synonyms | EPD PDE |
| Synonyms name | antiquitin 1 26g turgor protein homolog alpha-aminoadipic semialdehyde dehydrogenase alpha-AASA dehydrogenase delta1-piperideine-6-carboxylate dehydrogenease P6c dehydrogenase |
| Locus | 5q23, 2 |
| Discovery year | 1995-12-11 |
| GenBank acession | S74728 |
| Entrez gene record | 501 |
| Pubmed identfication | 9417906 |
| RefSeq identity | NM_001182 |
| Classification | Aldehyde dehydrogenases |
| Havana BLAST/BLAT | OTTHUMG00000128942 |
| Locus Specific Databases | BIOMBD |