Filters

ALDH7A1 Antibody

ALDH7A1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenALDH7A1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ALDH7A1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P49419
PurityAntigen affinity
Description An additional variant encoding a different isoform has also been found for this gene, It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix, Mutations in this gene are associated with pyridoxine-dependent epilepsy, Recent reports show that this protein is found both in the cytosol and the mitochondria, Several related pseudogenes have also been identified, The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family, These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation, This particular member has homology to a previously described protein from the green garden pea, also known as ALDH7A1 or antiquitin, and the two forms likely arise from the use of alternative translation initiation sites, is an enzyme that in humans is encoded by the ALDH7A1 gene, member A1, the 26g pea turgor protein, Aldehyde dehydrogenase 7 family
ImmunogenAmino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ALDH7A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetALDH7A1
Short nameALDH7A1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameALDH7A1 (Antibody to)
Alternative techniqueantibodies
Identity 877
Gene ALDH7A1
Long gene name aldehyde dehydrogenase 7 family member A1
Synonyms gene ATQ1
Synonyms gene name aldehyde dehydrogenase 7 family, member A1
Synonyms EPD PDE
Synonyms name antiquitin 1 26g turgor protein homolog alpha-aminoadipic semialdehyde dehydrogenase alpha-AASA dehydrogenase delta1-piperideine-6-carboxylate dehydrogenease P6c dehydrogenase
Locus 5q23, 2
Discovery year 1995-12-11
GenBank acession S74728
Entrez gene record 501
Pubmed identfication 9417906
RefSeq identity NM_001182
Classification Aldehyde dehydrogenases
Havana BLAST/BLAT OTTHUMG00000128942
Locus Specific Databases BIOMBD

Similar products

Subscribe to our Newsletter