Filters

AMACR / p504S Antibody (Prostate Cancer Marker)

AMACR / p504S Antibody (Prostate Cancer Marker) size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAMACR / p504S (Prostate Cancer Marker)
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis AMACR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9UHK6
PurityAntigen affinity
Description Alternatively spliced transcript variants have been described, Encoded proteins from this locus localize to both mitochondria and peroxisomes, It encodes a racemase, Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene, The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation, The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers, and adrenomyeloneuropathy due to defects in bile acid synthesis, pigmentary retinopathy, Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme
ImmunogenAmino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AMACR antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAMACR / p504S (Prostate Cancer
Short nameAMACR / p504S Antibody (Prostate Cancer Marker)
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameAMACR / p504S (Antibody to) (Prostate Cancer detection labelled)
Alternative techniqueantibodies
Identity 451
Gene AMACR
Long gene name alpha-methylacyl-CoA racemase
Synonyms RACE P504S
Locus 5p13, 2
Discovery year 1999-10-19
GenBank acession AF047020
Entrez gene record 23600
Pubmed identfication 9307041
RefSeq identity NM_014324
Havana BLAST/BLAT OTTHUMG00000090734

Similar products

Subscribe to our Newsletter