Name : Angiotensin II type-2 receptor Antibody
Supplier : NJS POLY
Price :406
SKU : GEN4932012577
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Angiotensin II type-2 receptor |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the Angiotensin II type-2 receptor antibody should be determined by the researcher |
| Intented use | This Angiotensin II type-2 receptor antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P50052 |
| Purity | Antigen affinity |
| Description | 2 or 3 and , However, In this sense, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, The receptors are ligand binding factors of type 1, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell |
| Immunogen | Amino acids FRVPITWLQGKRESMSCRKSSSLREMETFVS of human AGTR2 were used as the immunogen for the Angiotensin II type-2 receptor antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Angiotensin II type-2 receptor antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Angiotensin II 2 receptor |
| Short name | Angiotensin II type-2 receptor Antibody |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Angiotensin II classification-2 receptor (Antibody to) |
| Alternative technique | antibodies |