Filters

Angiotensin II type-2 receptor Antibody

Angiotensin II type-2 receptor Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAngiotensin II type-2 receptor
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the Angiotensin II type-2 receptor antibody should be determined by the researcher
Intented useThis Angiotensin II type-2 receptor antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P50052
PurityAntigen affinity
Description 2 or 3 and , However, In this sense, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, The receptors are ligand binding factors of type 1, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell
ImmunogenAmino acids FRVPITWLQGKRESMSCRKSSSLREMETFVS of human AGTR2 were used as the immunogen for the Angiotensin II type-2 receptor antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Angiotensin II type-2 receptor antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAngiotensin II 2 receptor
Short nameAngiotensin II type-2 receptor Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameAngiotensin II classification-2 receptor (Antibody to)
Alternative techniqueantibodies

Similar products

Subscribe to our Newsletter