Filters

APRIL Antibody

APRIL Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAPRIL
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications ELISA, WB
Recommended dilutions1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
NotesOptimal dilution of the APRIL antibody should be determined by the researcher
Intented useThis APRIL antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O75888
PurityAntigen affinity
Description Alternative splicing results in multiple transcript variants, And this protein is a ligand for TNFRSF17/BCMA, In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM, Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified, TNFSF12-TNFSF13, The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family, This protein and its receptor are both found to be important for B cell development, a member of the TNF receptor family, also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI, such read-through transcripts are contained in GeneID 407977, A proliferation-inducing ligand (APRIL)
ImmunogenAmino acids PINATSKDDSDVTEVMWQPALRRGRGLQAQ of human APRIL were used as the immunogen for the APRIL antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APRIL antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAPRIL
Short nameAPRIL Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameAPRIL (Antibody to)
Alternative techniqueantibodies
Identity 11928
Gene TNFSF13
Long gene name tumor necrosis factor superfamily member 13
Synonyms gene name member 13 , tumor necrosis factor (ligand) superfamily
Synonyms APRIL CD256
Locus 17p13, 1
Discovery year 1998-12-04
GenBank acession AF046888
Entrez gene record 8741
Pubmed identfication 9743536
RefSeq identity NM_003808
Classification Tumor necrosis factor superfamily CD molecules
Havana BLAST/BLAT OTTHUMG00000108145

Similar products

Subscribe to our Newsletter