Filters

ARC Antibody / Activity-regulated cytoskeleton-associated protein

ARC Antibody / Activity-regulated cytoskeleton-associated protein size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenARC / Activity-regulated cytoskeleton-associated protein
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the ARC antibody should be determined by the researcher
Intented useThis ARC antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q7LC44
PurityAntigen affinity
DescriptionArc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience
ImmunogenAmino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ARC antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetARC / Activity-regulated cytoskeleton-associated protein
Short nameARC Antibody / Activity-regulated cytoskeleton-associated protein
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameactivity-regulated cytoskeleton-associated protein (Antibody to) / Activity-regulated cytoskeleton-associated protein
Alternative techniqueantibodies
Alternative to gene target ARC and IDBG-37634 and ENSG00000198576 and 23237, ARC and IDBG-648018 and ENSBTAG00000021639 and 519403, Arc and IDBG-149967 and ENSMUSG00000022602 and 11838, Arg3, Cell surfaces, protein binding, this GO :0001669 and acrosomal vesicle and cellular component this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006897 and endocytosis and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007492 and endoderm development and biological process this GO :0007612 and learning and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0014069 and postsynaptic density and cellular component this GO :0015629 and actin cytoskeleton and cellular component this GO :0016477 and cell migration and biological process this GO :0022604 and regulation of cell morphogenesis and biological process this GO :0030054 and cell junction and cellular component this GO :0043197 and dendritic spine and cellular component this GO :0045211 and postsynaptic membrane and cellular component this GO :0048168 and regulation of neuronal synaptic plasticity and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, 1, activity-regulated cytoskeleton-associated protein
Identity 648
Gene ARC
Long gene name activity regulated cytoskeleton associated protein
Synonyms KIAA0278 Arg3, 1
Locus 8q24, 3
Discovery year 2000-05-23
GenBank acession AF193421
Entrez gene record 23237
Pubmed identfication 10970730 17466953
Havana BLAST/BLAT OTTHUMG00000134310

Similar products

Subscribe to our Newsletter