Filters

ARHGEF1 Antibody

ARHGEF1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenARHGEF1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ARHGEF1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q92888
PurityAntigen affinity
Description Multiple alternatively spliced transcript variants have been found for this gene, Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors, The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals, also called p115-RhoGEF, but the full-length nature of some variants has not been defined, is a protein that in humans is encoded by the ARHGEF1 gene, Rho guanine nucleotide exchange factor 1
ImmunogenAmino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ARHGEF1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membranous, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetARHGEF1
Short nameARHGEF1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameARHGEF1 (Antibody to)
Alternative techniqueantibodies
Identity 681
Gene ARHGEF1
Long gene name Rho guanine nucleotide exchange factor 1
Synonyms gene name Rho guanine nucleotide exchange factor (GEF) 1
Synonyms P115-RHOGEF SUB1, 5 LBCL2
Locus 19q13, 2
Discovery year 2000-03-10
GenBank acession U64105
Entrez gene record 9138
Pubmed identfication 8810315 9135076
RefSeq identity NM_199002
Classification Rho guanine nucleotide exchange factors
Havana BLAST/BLAT OTTHUMG00000182679

Similar products

Subscribe to our Newsletter