Filters

ASPH Antibody

ASPH Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenASPH
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the ASPH antibody should be determined by the researcher
Intented useThis ASPH antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q12797
PurityAntigen affinity
Description And the gene is expressed from two promoters and undergoes extensive alternative splicing, IX, Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, Some isoforms have been implicated in metastasis, Some of these isoforms are found in complexes with calsequestrin, The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties, The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, This gene is thought to play an important role in calcium homeostasis, and X, and have been shown to regulate calcium release from the sarcoplasmic reticulum, and some have been localized to the endoplasmic and sarcoplasmic reticulum, and the complement factors C1R and C1S, and the ryanodine receptor, coagulation factors VII, including protein C, triadin, ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase or aspartate beta-hydroxylase
ImmunogenAmino acids EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI of human ASPH were used as the immunogen for the ASPH antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ASPH antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetASPH
Short nameASPH Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameASPH (Antibody to)
Alternative techniqueantibodies
Identity 757
Gene ASPH
Long gene name aspartate beta-hydroxylase
Synonyms CASQ2BP1 BAH JCTN HAAH
Synonyms name junctin humbug junctate
Locus 8q12, 3
Discovery year 1995-06-13
GenBank acession AF224468
Entrez gene record 444
Pubmed identfication 7821814 10974562
RefSeq identity NM_004318
Havana BLAST/BLAT OTTHUMG00000164375

Similar products

Subscribe to our Newsletter