Name : ASPH Antibody
Supplier : NJS POLY
Price :406
SKU : GEN3286399121
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | ASPH |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the ASPH antibody should be determined by the researcher |
| Intented use | This ASPH antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | Q12797 |
| Purity | Antigen affinity |
| Description | And the gene is expressed from two promoters and undergoes extensive alternative splicing, IX, Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, Some isoforms have been implicated in metastasis, Some of these isoforms are found in complexes with calsequestrin, The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties, The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, This gene is thought to play an important role in calcium homeostasis, and X, and have been shown to regulate calcium release from the sarcoplasmic reticulum, and some have been localized to the endoplasmic and sarcoplasmic reticulum, and the complement factors C1R and C1S, and the ryanodine receptor, coagulation factors VII, including protein C, triadin, ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase or aspartate beta-hydroxylase |
| Immunogen | Amino acids EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI of human ASPH were used as the immunogen for the ASPH antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ASPH antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | ASPH |
| Short name | ASPH Antibody |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | ASPH (Antibody to) |
| Alternative technique | antibodies |
| Identity | 757 |
| Gene | ASPH |
| Long gene name | aspartate beta-hydroxylase |
| Synonyms | CASQ2BP1 BAH JCTN HAAH |
| Synonyms name | junctin humbug junctate |
| Locus | 8q12, 3 |
| Discovery year | 1995-06-13 |
| GenBank acession | AF224468 |
| Entrez gene record | 444 |
| Pubmed identfication | 7821814 10974562 |
| RefSeq identity | NM_004318 |
| Havana BLAST/BLAT | OTTHUMG00000164375 |