Filters

ATG14L Antibody

ATG14L Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenATG14L
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the ATG14L antibody should be determined by the researcher
Intented useThis ATG14L antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q6ZNE5
PurityAntigen affinity
Description ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8), promotes membrane tethering of protein-free liposomes, ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L)
ImmunogenAmino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ATG14L antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetATG14L
Short nameATG14L Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameATG14L (Antibody to)
Alternative techniqueantibodies
Identity 19962
Gene ATG14
Long gene name autophagy related 14
Synonyms gene KIAA0831
Synonyms gene name KIAA0831 ATG14 autophagy related 14 homolog (S, cerevisiae)
Synonyms ATG14L
Synonyms name Barkor beclin 1-associated autophagy-related key regulator
Locus 14q22, 3
Discovery year 2003-11-21
GenBank acession AB020638
Entrez gene record 22863
Pubmed identfication 18843052
RefSeq identity NM_014924
Classification Autophagy related
Havana BLAST/BLAT OTTHUMG00000172129

Similar products

Subscribe to our Newsletter