Filters

BCAR3 Antibody

BCAR3 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenBCAR3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the BCAR3 antibody should be determined by the researcher
Intented useThis BCAR3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O75815
PurityAntigen affinity
Description BCAR3 was identified in the search for genes involved in the development of estrogen resistance, Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen, However, Multiple transcript variants encoding different isoforms have been found for this gene, The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells, The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48, breast cancers progress to become anti-estrogen resistant, Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene
ImmunogenAmino acids KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL of human BCAR3 were used as the immunogen for the BCAR3 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the BCAR3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membranous, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetBCAR3
Short nameBCAR3 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameBCAR3 (Antibody to)
Alternative techniqueantibodies
Identity 973
Gene BCAR3
Long gene name breast cancer anti-estrogen resistance 3
Synonyms NSP2 SH2D3B
Locus 1p22, 1
Discovery year 1999-04-29
GenBank acession U92715
Entrez gene record 8412
Pubmed identfication 9582273
Classification SH2 domain containing
Havana BLAST/BLAT OTTHUMG00000010301

Similar products

Subscribe to our Newsletter