Filters

CD41 Antibody / ITGA2B

CD41 Antibody / ITGA2B size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenCD41 / ITGA2B
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the CD41 antibody should be determined by the researcher
Intented useThis CD41 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P08514
PurityAntigen affinity
Description Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation, In addition to adhesion, Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain, It is mapped to 17q21, Mutations that interfere with this role result in thrombasthenia, integrins are known to participate in cell-surface mediated signalling, 32, Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene
ImmunogenAmino acids EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN of human ITGA2B/CD41 were used as the immunogen for the CD41 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CD41 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetCD41 / ITGA2B
Short nameCD41 Antibody / ITGA2B
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name a 2b (platelet glycoprotein IIb on IIb/IIIa complex, antigen CD41), CD41 (Antibody to) / integrin
Alternative techniqueantibodies
Alternative to gene target BDPLT16 and BDPLT2 and CD41 and CD41B and GP2B and GPIIb and GT and GTA and HPA3 and PPP1R93, Cell surfaces, ITGA2B and IDBG-53910 and ENSG00000005961 and 3674, ITGA2B and IDBG-640964 and ENSBTAG00000008165 and 515011, Itga2b and IDBG-212667 and ENSMUSG00000034664 and 16399, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41), fibrinogen binding, this GO :0002576 and platelet degranulation and biological process this GO :0002687 and positive regulation of leukocyte migration and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007160 and cell-matrix adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007411 and axon guidance and biological process this GO :0007596 and blood coagulation and biological process this GO :0008305 and integrin complex and cellular component this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0031092 and platelet alpha granule membrane and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0050840 and extracellular matrix binding and molecular function this GO :0070051 and fibrinogen binding and molecular function this GO :0070527 and platelet aggregation and biological process this GO :0072562 and blood microparticle and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0042802: identical protein binding and also this GO :0046872: metal ion binding and also this GO :0050840: extracellular matrix binding and also this GO :0070051: fibrinogen binding, this GO :0042802: identical protein binding, this GO :0046872: metal ion binding, this GO :0050840: extracellular matrix binding, this GO :0070051: fibrinogen binding, integrin
Identity 6138
Gene ITGA2B
Long gene name integrin subunit alpha 2b
Synonyms gene GP2B
Synonyms gene name alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) , antigen CD41B) integrin, integrin
Synonyms CD41B CD41 PPP1R93
Synonyms name protein phosphatase 1, regulatory subunit 93 platelet glycoprotein IIb of IIb/IIIa complex
Locus 17q21, 31
Discovery year 1986-01-01
Entrez gene record 3674
Classification Integrin alpha subunits CD molecules Protein phosphatase 1 regulatory subunits
Havana BLAST/BLAT OTTHUMG00000177935
Locus Specific Databases LRG_479

Similar products

Subscribe to our Newsletter