Filters

Chk2 Antibody / CHEK2

Chk2 Antibody / CHEK2 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenChk2 / CHEK2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the Chk2 antibody should be determined by the researcher
Intented useThis Chk2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O96017
PurityAntigen affinity
Description CDC25B and CDC25C, Following activation, May also negatively regulate cell cycle progression during unperturbed cell cycles, Regulates cell cycle checkpoint arrest through phosphorylation of CDC25A, [UniProt], activation of DNA repair and apoptosis in response to the presence of DNA double-strand breaks, inhibiting their activity, phosphorylates numerous effectors preferentially at the consensus sequence [L-X-R-X-X-S/T], Chk2 is a serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest
ImmunogenAmino acids KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL of human Chk2/CHEK2 were used as the immunogen for the Chk2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Chk2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetChk2 / CHEK2
Short nameChk2 Antibody / CHEK2
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameChk2 (Antibody to) / checkpoint kinase 2
Alternative techniqueantibodies
Alternative to gene target CDS1 and CHK2 and hCds1 and HuCds1 and LFS2 and PP1425 and RAD53, CHEK2 and IDBG-3314 and ENSG00000183765 and 11200, CHEK2 and IDBG-636030 and ENSBTAG00000004956 and 518897, Chek2 and IDBG-190635 and ENSMUSG00000029521 and 50883, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0006975 and DNA damage induced protein phosphorylation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0016301 and kinase activity and molecular function this GO :0016605 and PML body and cellular component this GO :0016772 and transferase activity, DNA-templated and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050821 and protein stabilization and biological process this GO :0072428 and signal transduction involved in intra-S DNA damage checkpoint and biological process this GO :0090307 and spindle assembly involved in mitosis and biological process this GO :0090399 and replicative senescence and biological process, nuclei, telomeric region and cellular component this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0006302 and double-strand break repair and biological process this GO :0006351 and transcription, this GO :0000077 and DNA damage checkpoint and biological process this GO :0000086 and G2/M transition of mitotic cell cycle and biological process this GO :0000781 and chromosome, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity and also this GO :0004674: protein serine/threonine kinase activity and also this GO :0004713: protein tyrosine kinase activity and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0016301: kinase activity and also this GO :0016772: transferase activity, this GO :0004674: protein serine/threonine kinase activity, this GO :0004713: protein tyrosine kinase activity, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0016301: kinase activity, this GO :0016772: transferase activity, this GO :0019901: protein kinase binding, this GO :0031625: ubiquitin protein ligase binding, this GO :0042802: identical protein binding, this GO :0042803: protein homodimerization activity, this GO :0046872: metal ion binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019901: protein kinase binding and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0042802: identical protein binding and also this GO :0042803: protein homodimerization activity and also this GO :0046872: metal ion binding, transferring phosphorus-containing groups and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0042176 and regulation of protein catabolic process and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0044257 and cellular protein catabolic process and biological process this GO :0045893 and positive regulation of transcription, checkpoint kinase 2
Identity 16627
Gene CHEK2
Long gene name checkpoint kinase 2
Synonyms gene RAD53
Synonyms gene name CHK2 (checkpoint, S, pombe) , pombe) homolog CHK2 checkpoint homolog (S
Synonyms CDS1 CHK2 HuCds1 PP1425 bA444G7
Locus 22q12, 1
Discovery year 2001-09-19
GenBank acession AF086904
Entrez gene record 11200
Pubmed identfication 9836640 10097108
RefSeq identity NM_001005735
Havana BLAST/BLAT OTTHUMG00000151023
Locus Specific Databases LRG_302

Similar products

Subscribe to our Newsletter