Filters

Cofilin 2 Antibody / CFL2

Cofilin 2 Antibody / CFL2 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenCofilin 2 / CFL2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0
NotesOptimal dilution of the Cofilin 2 antibody should be determined by the researcher
Intented useThis Cofilin 2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9Y281
PurityAntigen affinity
Description Alternative splicing results in multiple transcript variants, And this protein is a major component of intranuclear and cytoplasmic actin rods, It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, It is mapped to 14q12, Mutations in this gene cause nemaline myopathy type 7, This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics, a form of congenital myopathy, also known as CFL2, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner, is a protein which in humans is encoded by the CFL2 gene, Cofilin 2 (muscle)
ImmunogenAmino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Cofilin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetCofilin 2 / CFL2
Short nameCofilin 2 Antibody / CFL2
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameCofilin 2 (Antibody to) / CFL2
Alternative techniqueantibodies
Identity 1875
Gene CFL2
Long gene name cofilin 2
Synonyms gene name cofilin 2 (muscle)
Synonyms NEM7
Synonyms name nemaline myopathy type 7
Locus 14q13, 1
Discovery year 1995-07-11
GenBank acession AF087867
Entrez gene record 1073
Pubmed identfication 8800436
RefSeq identity NM_138638
Havana BLAST/BLAT OTTHUMG00000029536
Locus Specific Databases Leiden Muscular Dystrophy pages LRG_213

Similar products

Subscribe to our Newsletter