Filters

Connexin 45 Antibody / GJC1

Connexin 45 Antibody / GJC1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenConnexin 45 / GJC1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the Connexin 45 antibody should be determined by the researcher
Intented useThis Connexin 45 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P36383
PurityAntigen affinity
Description The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21, The encoded protein is a component of gap junctions, This gene is a member of the connexin gene family, also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell, 31, Gap junction gamma-1 protein (GJC1)
ImmunogenAmino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Connexin 45 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetConnexin 45 / GJC1
Short nameConnexin 45 Antibody / GJC1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameConnexin 45 (Antibody to) / GJC1
Alternative techniqueantibodies
Identity 4280
Gene GJC1
Long gene name gap junction protein gamma 1
Synonyms gene GJA7
Synonyms gene name 45kDa , 45kDa gap junction protein, alpha 7, gamma 1, gap junction protein
Synonyms CX45
Synonyms name connexin 45
Locus 17q21, 31
Discovery year 1999-07-30
GenBank acession U03493
Entrez gene record 10052
Pubmed identfication 7966354
RefSeq identity NM_005497
Classification Gap junction proteins
Havana BLAST/BLAT OTTHUMG00000179861

Similar products

Subscribe to our Newsletter