Filters

Connexin 46 Antibody / GJA3

Connexin 46 Antibody / GJA3 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenConnexin 46 / GJA3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the Connexin 46 antibody should be determined by the researcher
Intented useThis Connexin 46 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9Y6H8
PurityAntigen affinity
Description Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3), One gap junction consists of a cluster of closely packed pairs of transmembrane channels, The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions, This gene is mapped to 13q12, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell, 11, Gap junction alpha-3 protein
ImmunogenAmino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Connexin 46 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetConnexin 46 / GJA3
Short nameConnexin 46 Antibody / GJA3
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameConnexin 46 (Antibody to) / GJA3
Alternative techniqueantibodies
Identity 4277
Gene GJA3
Long gene name gap junction protein alpha 3
Synonyms gene CZP3
Synonyms gene name 46kD (connexin 46) gap junction protein, 46kDa , 46kDa (connexin 46) gap junction protein, alpha 3, alpha 3, alpha 3, gap junction protein
Synonyms CX46
Synonyms name connexin 46
Locus 13q12, 11
Discovery year 1990-02-12
GenBank acession AF075290
Entrez gene record 2700
Pubmed identfication 10205266 7342922
RefSeq identity NM_021954
Classification Gap junction proteins
Havana BLAST/BLAT OTTHUMG00000016510

Similar products

Subscribe to our Newsletter