Filters

CRY2 Antibody

CRY2 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenCRY2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the CRY2 antibody should be determined by the researcher
Intented useThis CRY2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q49AN0
PurityAntigen affinity
Description And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL, Polymorphisms in this gene have been associated with altered sleep patterns, The encoded protein is widely conserved across plants and animals, Two transcript variants encoding different isoforms have been found for this gene, which regulates the circadian clock, This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex
ImmunogenAmino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CRY2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetCRY2
Short nameCRY2 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameCRY2 (Antibody to)
Alternative techniqueantibodies
Identity 2385
Gene CRY2
Long gene name cryptochrome circadian clock 2
Synonyms gene name cryptochrome 2 (photolyase-like)
Locus 11p11, 2
Discovery year 1997-03-21
GenBank acession AB014558
Entrez gene record 1408
Pubmed identfication 8909283
RefSeq identity NM_021117
Havana BLAST/BLAT OTTHUMG00000153225

Similar products

Subscribe to our Newsletter