Filters

Cryptochrome I Antibody

Cryptochrome I Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenCryptochrome I
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the Cryptochrome I antibody should be determined by the researcher
Intented useThis Cryptochrome I antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q16526
PurityAntigen affinity
Description And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL, Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness, Polymorphisms in this gene have been associated with altered sleep patterns, The encoded protein is widely conserved across plants and animals, which regulates the circadian clock, This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex
ImmunogenAmino acids FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK of human Cryptochrome I were used as the immunogen for the Cryptochrome I antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Cryptochrome I antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear and cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetCryptochrome I
Short nameCryptochrome I Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameCryptochrome I (Antibody to)
Alternative techniqueantibodies

Similar products

Subscribe to our Newsletter