Name : Cryptochrome I Antibody
Supplier : NJS POLY
Price :406
SKU : GEN6307180437
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Cryptochrome I |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the Cryptochrome I antibody should be determined by the researcher |
| Intented use | This Cryptochrome I antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | Q16526 |
| Purity | Antigen affinity |
| Description | And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL, Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness, Polymorphisms in this gene have been associated with altered sleep patterns, The encoded protein is widely conserved across plants and animals, which regulates the circadian clock, This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex |
| Immunogen | Amino acids FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK of human Cryptochrome I were used as the immunogen for the Cryptochrome I antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Cryptochrome I antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Nuclear and cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Cryptochrome I |
| Short name | Cryptochrome I Antibody |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Cryptochrome I (Antibody to) |
| Alternative technique | antibodies |