Filters

Cyclin T1 Antibody

Cyclin T1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenCyclin T1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis Cyclin T1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O60563
PurityAntigen affinity
Description Alternative splicing results in multiple transcript variants, In humans, Overexpression of this gene is implicated in tumor growth, The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, The encoded protein tightly associates with cyclin-dependent kinase 9, This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit, This gene encodes a member of the highly conserved cyclin C subfamily, and is a major subunit of positive transcription elongation factor b (p-TEFb), and is both necessary and sufficient for full activation of viral transcription, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9, Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene
ImmunogenAmino acids QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM from the human protein were used as the immunogen for the Cyclin T1 antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the Cyclin T1 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetCyclin T1
Short nameCyclin T1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameCyclin T1 (Antibody to)
Alternative techniqueantibodies
Identity 1599
Gene CCNT1
Long gene name cyclin T1
Synonyms gene HIVE1
Synonyms gene name human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
Synonyms CCNT CYCT1
Locus 12q13, 11-q13, 12
Discovery year 1998-04-29
GenBank acession AF048730
Entrez gene record 904
Pubmed identfication 9491887 9499409
RefSeq identity NM_001240
Classification Cyclins P-TEFb complex
Havana BLAST/BLAT OTTHUMG00000170393

Similar products

Subscribe to our Newsletter