Filters

DGAT1 Antibody

DGAT1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenDGAT1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the DGAT antibody should be determined by the researcher
Intented useThis DGAT antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O75907
PurityAntigen affinity
Description DGAT had been considered necessary for adipose tissue formation and essential for survival, DGAT1 is a host factor for HCV infection that binds core protein, DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2, and recruits viral RNA replication complexes for viral assembly, localizes it to DGAT1-generated lipid droplets, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics, Acyl-CoA: diacylglycerol acyltransferase 1 (DGAT1) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates
ImmunogenAmino acids RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR of human DGAT1 were used as the immunogen for the DGAT antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DGAT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetDGAT1
Short nameDGAT1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameDGAT1 (Antibody to)
Alternative techniqueantibodies
Identity 2843
Gene DGAT1
Long gene name diacylglycerol O-acyltransferase 1
Synonyms gene name diacylglycerol O-acyltransferase homolog 1 (mouse)
Synonyms ARGP1 DGAT
Locus 8q24, 3
Discovery year 1998-11-11
GenBank acession AF059202
Entrez gene record 8694
Pubmed identfication 9756920
RefSeq identity NM_012079
Havana BLAST/BLAT OTTHUMG00000174606

Similar products

Subscribe to our Newsletter