Name : ERp57 Antibody / PDIA3
Supplier : NJS POLY
Price :406
SKU : GEN2384571477
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | ERp57 / PDIA3 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the PDIA3 antibody should be determined by the researcher |
| Intented use | This PDIA3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P30101 |
| Purity | Antigen affinity |
| Description | Erp57 or ER60, It is mapped on 15q15, It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates, PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, The protein was once thought to be a phospholipase, This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins, also called GRP58, however, is an isomerase enzyme, it has been demonstrated that the protein actually has protein disulfide isomerase activity, member 3), which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface, 3, PDIA3 (Protein disulfide isomerase family A |
| Immunogen | Amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL of human PDIA3/ERp57 were used as the immunogen for the PDIA3 antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PDIA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | membrane, Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | ERp57 / PDIA3 |
| Short name | ERp57 Antibody / PDIA3 |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | member 3, ERp57 (Antibody to) / protein disulfide isomerase family A |
| Alternative technique | antibodies |
| Alternative to gene target | ER60 and ERp57 and ERp60 and ERp61 and GRP57 and GRP58 and HEL-S-269 and HEL-S-93n and HsT17083 and P58 and PI-PLC, PDIA3 and IDBG-633244 and ENSBTAG00000017196 and 281803, PDIA3 and IDBG-9160 and ENSG00000167004 and 2923, Pdia3 and IDBG-202293 and ENSMUSG00000027248 and 14827, TAP-dependent and biological process this GO :0003756 and protein disulfide isomerase activity and molecular function this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0004629 and phospholipase C activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005790 and smooth endoplasmic reticulum and cellular component this GO :0006457 and protein folding and biological process this GO :0006508 and proteolysis and biological process this GO :0006606 and protein import into nucleus and biological process this GO :0006621 and protein retention in ER lumen and biological process this GO :0006662 and glycerol ether metabolic process and biological process this GO :0007165 and signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0015035 and protein disulfide oxidoreductase activity and molecular function this GO :0016853 and isomerase activity and molecular function this GO :0018279 and protein N-linked glycosylation via asparagine and biological process this GO :0034976 and response to endoplasmic reticulum stress and biological process this GO :0042470 and melanosome and cellular component this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0043687 and post-translational protein modification and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045454 and cell redox homeostasis and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, member 3, nuclei, poly(A) RNA binding, this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0003756: protein disulfide isomerase activity, this GO :0003756: protein disulfide isomerase activity and also this GO :0004197: cysteine-type endopeptidase activity and also this GO :0004629: phospholipase C activity and also this GO :0005515: protein binding and also this GO :0015035: protein disulfide oxidoreductase activity and also this GO :0016853: isomerase activity and also this GO :0044822: poly(A) RNA binding, this GO :0004197: cysteine-type endopeptidase activity, this GO :0004629: phospholipase C activity, this GO :0005515: protein binding, this GO :0015035: protein disulfide oxidoreductase activity, this GO :0016853: isomerase activity, this GO :0044822: poly(A) RNA binding, protein disulfide isomerase family A |
| Identity | 4606 |
| Gene | PDIA3 |
| Long gene name | protein disulfide isomerase family A member 3 |
| Synonyms gene | GRP58 |
| Synonyms gene name | 58kDa protein disulfide isomerase-associated 3 protein disulfide isomerase family A, glucose regulated protein, member 3 |
| Synonyms | P58 ERp61 ERp57 ERp60 GRP57 PI-PLC HsT17083 |
| Locus | 15q15, 3 |
| Discovery year | 1997-06-09 |
| Entrez gene record | 2923 |
| Pubmed identfication | 8974399 |
| RefSeq identity | NM_005313 |
| Classification | Protein disulfide isomerases |
| Havana BLAST/BLAT | OTTHUMG00000044444 |