Filters

EWS Antibody / EWSR1

EWS Antibody / EWSR1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenEWS / EWSR1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the EWSR1 antibody should be determined by the researcher
Intented useThis EWSR1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q01844
PurityAntigen affinity
Description Alternative splicing of this gene results in multiple transcript variants, Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis, Mutations in this gene, Related pseudogenes have been identified on chromosomes 1 and 14, The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain, These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein, and RNA processing and transport, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors, cell signaling, including gene expression, specifically a t(11, 22)(q24, This gene encodes a multifunctional protein that is involved in various cellular processes, q12) translocation
ImmunogenAmino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the EWSR1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetEWS / EWSR1
Short nameEWS Antibody / EWSR1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameEWS (Antibody to) / EWSR1
Alternative techniqueantibodies
Identity 3508
Gene EWSR1
Long gene name EWS RNA binding protein 1
Synonyms gene name Ewing sarcoma breakpoint region 1
Synonyms EWS
Locus 22q12, 2
Discovery year 1992-11-27
Entrez gene record 2130
Pubmed identfication 1522903
RefSeq identity NM_005243
Classification Zinc fingers RANBP2-type RNA binding motif containing
Havana BLAST/BLAT OTTHUMG00000151107

Similar products

Subscribe to our Newsletter