Filters

Fetuin-A Antibody / AHSG

Fetuin-A Antibody / AHSG size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenFetuin-A / AHSG
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications ELISA, IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the AHSG antibody should be determined by the researcher
Intented useThis AHSG antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P02765
PurityAntigen affinity
Description Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood, It is involved in several functions, Its gene is mapped to 3q27, The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, also known as Fetuin-A, brain development and the formation of bone tissue, is a protein that in humans is encoded by the AHSG gene, such as endocytosis, Alpha-2-HS-glycoprotein (AHSG)
ImmunogenAmino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AHSG antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetFetuin-A / AHSG
Short nameFetuin-A Antibody / AHSG
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameFetuin-A (Antibody to) / alpha-2-HS-glycoprotein
Alternative techniqueantibodies
Alternative to gene target A2HS and AHS and FETUA and HSGA, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988, AHSG and IDBG-68916 and ENSG00000145192 and 197, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, Extracellular, kinase inhibitor activity, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004869 and cysteine-type endopeptidase inhibitor activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006907 and pinocytosis and biological process this GO :0006953 and acute-phase response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019210 and kinase inhibitor activity and molecular function this GO :0030500 and regulation of bone mineralization and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0045087 and innate immune response and biological process this GO :0046627 and negative regulation of insulin receptor signaling pathway and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004869: cysteine-type endopeptidase inhibitor activity, this GO :0004869: cysteine-type endopeptidase inhibitor activity and also this GO :0019210: kinase inhibitor activity, this GO :0019210: kinase inhibitor activity, alpha-2-HS-glycoprotein
Identity 349
Gene AHSG
Long gene name alpha 2-HS glycoprotein
Synonyms FETUA A2HS HSGA
Synonyms name fetuin A
Locus 3q27, 3
Discovery year 1986-01-01
GenBank acession D67013 M16961
Entrez gene record 197
Pubmed identfication 9322749 7736783
RefSeq identity NM_001622
Classification Cystatins, type 4
Havana BLAST/BLAT OTTHUMG00000156605

Similar products

Subscribe to our Newsletter