Name : Fetuin-A Antibody / AHSG
Supplier : NJS POLY
Price :406
SKU : GEN2689144721
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Fetuin-A / AHSG |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | ELISA, IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the AHSG antibody should be determined by the researcher |
| Intented use | This AHSG antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P02765 |
| Purity | Antigen affinity |
| Description | Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood, It is involved in several functions, Its gene is mapped to 3q27, The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, also known as Fetuin-A, brain development and the formation of bone tissue, is a protein that in humans is encoded by the AHSG gene, such as endocytosis, Alpha-2-HS-glycoprotein (AHSG) |
| Immunogen | Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AHSG antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Fetuin-A / AHSG |
| Short name | Fetuin-A Antibody / AHSG |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Fetuin-A (Antibody to) / alpha-2-HS-glycoprotein |
| Alternative technique | antibodies |
| Alternative to gene target | A2HS and AHS and FETUA and HSGA, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988, AHSG and IDBG-68916 and ENSG00000145192 and 197, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, Extracellular, kinase inhibitor activity, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004869 and cysteine-type endopeptidase inhibitor activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006907 and pinocytosis and biological process this GO :0006953 and acute-phase response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019210 and kinase inhibitor activity and molecular function this GO :0030500 and regulation of bone mineralization and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0045087 and innate immune response and biological process this GO :0046627 and negative regulation of insulin receptor signaling pathway and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004869: cysteine-type endopeptidase inhibitor activity, this GO :0004869: cysteine-type endopeptidase inhibitor activity and also this GO :0019210: kinase inhibitor activity, this GO :0019210: kinase inhibitor activity, alpha-2-HS-glycoprotein |
| Identity | 349 |
| Gene | AHSG |
| Long gene name | alpha 2-HS glycoprotein |
| Synonyms | FETUA A2HS HSGA |
| Synonyms name | fetuin A |
| Locus | 3q27, 3 |
| Discovery year | 1986-01-01 |
| GenBank acession | D67013 M16961 |
| Entrez gene record | 197 |
| Pubmed identfication | 9322749 7736783 |
| RefSeq identity | NM_001622 |
| Classification | Cystatins, type 4 |
| Havana BLAST/BLAT | OTTHUMG00000156605 |